KEGG   Dehalococcoides mccartyi CBDB1: cbdb_A63Help
Entry
cbdb_A63          CDS       T00273                                 

Definition
transcriptional repressor, ROK family
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
deh  Dehalococcoides mccartyi CBDB1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:deh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    cbdb_A63
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    cbdb_A63
   00052 Galactose metabolism
    cbdb_A63
   00500 Starch and sucrose metabolism
    cbdb_A63
   00520 Amino sugar and nucleotide sugar metabolism
    cbdb_A63
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    cbdb_A63
   00524 Butirosin and neomycin biosynthesis
    cbdb_A63
Enzymes [BR:deh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     cbdb_A63
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
40843..41850
Genome map
AA seq 335 aa AA seqDB search
MNRSNSEVMSKPCLCLDIGGSKIRSAVVTHDGRVVAWEQEPTCARNGVTGVFESICRVLD
RLLARNNLNTSQFEALAAAVAGGIDMPNGLVTQSPHLPDWRDVPLRDMLTERYLKTFIIN
DASAAALGEHRLGVGLGVKNLVYLTVSTGIGGGIIINNELYLGQSGCAGEIGHMCLDING
KEDVCGNKGCLETLASGTAIVSRVQTELAGGEFSILVERFKADYSALTAEDIGRAASEGD
RLCLGIIRQAGEYLGIGLVNIANIFNPELIILGGGVSKLGEIFIEPARQVLYKRAFRLAG
DDVRLIVSVLGDNAGVIGAALYAYACLDSANNQPQ
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
ttgaaccgtagtaattcagaggttatgagcaagccctgtttgtgtctggatataggcggc
agtaaaatccgttcggcggtggtcacccatgacggacgggtggtggcttgggaacaggag
cctacctgtgcccgaaacggggtaacgggtgtatttgagagtatctgccgggtgcttgac
cgcttgcttgcgcgtaacaacctgaatacctcacagtttgaggcacttgctgcggcggtt
gccgggggtatagatatgccaaacgggctggttacccagtctccccatttgcccgactgg
cgggacgtgcccctcagggatatgcttacagaacgttatctcaagacctttattataaat
gatgcttcggctgcggcactgggtgaacaccgtctgggagtggggctgggagttaaaaat
ctggtttacctgaccgtttccaccggtatcgggggcggtattattataaataacgagctg
tatctggggcagagcggctgtgccggtgaaatagggcatatgtgtctggatataaacggt
aaggaagatgtctgcggcaacaaaggctgtttggaaacactggcttcgggtacggctatt
gtcagcagggttcagaccgaacttgctgggggtgaattttccatactggtagaacgcttc
aaggcggattattcggctttgaccgcagaggatataggcagggcggcttcagagggtgac
aggctgtgtctggggattatccgtcaggcaggggaatatctgggaatcgggctggtgaat
attgccaatatatttaacccggagcttattatactggggggcggggtttccaagctggga
gagatatttattgagcctgcccgccaagtgctttataaacgggctttccgtctggcgggg
gatgatgtccgcctgatagtttcggttctgggggataatgccggggtgattggggcagct
ctgtatgcctatgcctgtctggatagtgcgaacaaccagcctcagtga

DBGET integrated database retrieval system