KEGG   Dehalococcoides mccartyi CBDB1: cbdb_A667Help
Entry
cbdb_A667         CDS       T00273                                 

Definition
carbohydrate kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
deh  Dehalococcoides mccartyi CBDB1
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:deh00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    cbdb_A667
Enzymes [BR:deh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     cbdb_A667
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(548603..549589)
Genome map
AA seq 328 aa AA seqDB search
MTTCSLEAIGLGAVHVDHIYTVEQILHDGECVVTESASFPGGSGANTIHGLSRLGLKCGF
IGAVGNDSDGNLLIKDFENAGIDNQYLMVTDEAQTGSVVSLSESSGRRSTYVNPGANNYL
NLSDINLEYLSQAKLVHMSTFFSQNEFALCHEIAERLAPDVLFSFSPGALFAAQGLKRLA
PILSRTNALFTNQLDIEKMTQKNYQRATDMCIRSGCEHVVVTLGESRRFQRKGKITLQTY
IRDKDHECHMESTVSLRKDIRTVVDTIGAADAFTTGFLFGLMGDKPIEECGLLGDISARF
CISKLGARSGLPNLEGLKERFGMHYFTN
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgactacttgtagtcttgaggctatcggcttgggggcggtgcatgtagatcatatatat
actgtggagcaaatactccatgacggcgaatgtgtagtcaccgaatctgcctcattcccc
ggcggttcaggtgcaaatactatacatgggttatcccggctgggattaaaatgcggcttc
ataggagcagtgggaaatgactctgacggcaacctgttgattaaagactttgaaaacgca
ggtatagataaccagtacctgatggtaacggacgaagcccaaacgggctcagtggtttca
ctaagtgaatcttccgggcgccgctcaacatatgtaaatcccggtgccaacaattacctt
aacctttctgatatcaatctggagtacttaagccaagccaagctggttcatatgtcaact
ttcttcagccagaatgaatttgccctttgccatgaaatagcggaacggctggcaccggat
gtacttttcagcttttcacccggagccctctttgccgcccaggggctgaaaaggcttgct
cccattctttcacgcacaaatgcccttttcaccaaccaactggatatagagaaaatgacc
caaaagaattatcagcgggctacggatatgtgtatccgcagcggatgtgaacatgtggta
gttactctgggagagagccgccgttttcaacgaaaaggcaaaataaccctccagacctat
atacgggacaaagaccacgagtgccatatggagtcaaccgtcagcctcaggaaagatatc
cgtaccgtagtggatacaataggtgcggcagatgcctttaccaccggtttccttttcggg
cttatgggggataaacccattgaagagtgcggcttgctgggggatatttctgcccgtttc
tgcataagcaagctgggtgcccgttcaggtttgcccaatctggaaggactaaaagaacgc
ttcggcatgcactattttactaactga

DBGET integrated database retrieval system