KEGG   Dehalococcoides mccartyi CBDB1: cbdb_A680Help
Entry
cbdb_A680         CDS       T00273                                 

Gene name
porD
Definition
(RefSeq) pyruvic-ferredoxin oxidoreductase subunit delta (EC:1.2.7.1)
  KO
K00171  
pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
deh  Dehalococcoides mccartyi CBDB1
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:deh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    cbdb_A680 (porD)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    cbdb_A680 (porD)
   00020 Citrate cycle (TCA cycle)
    cbdb_A680 (porD)
   00620 Pyruvate metabolism
    cbdb_A680 (porD)
   00640 Propanoate metabolism
    cbdb_A680 (porD)
   00650 Butanoate metabolism
    cbdb_A680 (porD)
  Energy metabolism
   00680 Methane metabolism
    cbdb_A680 (porD)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    cbdb_A680 (porD)
Enzymes [BR:deh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     cbdb_A680 (porD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
559701..559961
Genome map
AA seq 86 aa AA seqDB search
MTPGCIVSEPGNASQYKTGDWRSQLPIHNFKKCIKCGVCYIFCPEGCINETKEGFFEADL
FYCKGCGICAHECPTGAIVMKDEEEK
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
gtgacacccggctgtatagtcagtgaacccggcaatgccagccagtacaagaccggtgat
tggcgttcccaactacctattcacaattttaaaaaatgtataaaatgcggcgtatgctat
atattttgccccgaaggttgcataaatgagaccaaagagggctttttcgaagcagacctt
ttctattgcaagggttgcggcatctgcgctcatgaatgtcccaccggagctattgttatg
aaggatgaggaggagaaataa

DBGET integrated database retrieval system