KEGG   Dehalococcoides mccartyi CBDB1: cbdb_A681Help
Entry
cbdb_A681         CDS       T00273                                 

Gene name
porA
Definition
(RefSeq) pyruvic-ferredoxin oxidoreductase subunit alpha (EC:1.2.7.1)
  KO
K00169  
pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
deh  Dehalococcoides mccartyi CBDB1
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:deh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    cbdb_A681 (porA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    cbdb_A681 (porA)
   00020 Citrate cycle (TCA cycle)
    cbdb_A681 (porA)
   00620 Pyruvate metabolism
    cbdb_A681 (porA)
   00640 Propanoate metabolism
    cbdb_A681 (porA)
   00650 Butanoate metabolism
    cbdb_A681 (porA)
  Energy metabolism
   00680 Methane metabolism
    cbdb_A681 (porA)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    cbdb_A681 (porA)
Enzymes [BR:deh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     cbdb_A681 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
559961..561133
Genome map
AA seq 390 aa AA seqDB search
MPRVGLEVSIALSEAVGLCNADVIAAYPITPQTHIVEHLAEMVAEGELDAEYIPVESEHS
ALSACLGSAAAGARTFTATAGQGLELMHEVLYVASSMRLPIMMAVANRALSGPLSVWGDH
SDVMSCRDIGWIQIFTENGQEVVDNTICSFKIGEDKRVLLPVMVHLDGFHLSHVIEPIEM
PERKQVDAFLSVNDYPYALNPDNPRAMGDFAPPVIFTEAKWAQEQDFQKSKAVILEVWKD
FEKQFGRSYKPVETYRTEGAENLLFTMGSFSETAMSAIDKMRDDGMSVGLVRLRLWRPFP
FEELRTAVKDAKNLIVLDRALSIGGPGGPVCSEIKAALYPLEKKPKIVSIIGGLGGRDIT
VANFEDIMKKGLAIAEKGSPNEYEIYGVRA
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgcccagagtaggcttagaagtttctattgccctgagtgaggcagttgggctttgcaat
gctgatgttattgctgcttatcccattactcctcaaactcatattgttgaacatttggcc
gagatggtggctgaaggcgagctggatgctgaatatataccggtggaatctgaacattca
gccctgagtgcctgtttgggctcggcggcagccggtgcccgcacttttaccgcaactgcc
gggcaagggcttgagcttatgcacgaggtgctttatgtggcttcctctatgcggctgcct
attatgatggcagttgccaatagggctctttccggtccgctttcagtttggggtgaccac
tctgacgtaatgtcctgccgtgatatcggctggatacaaatatttactgaaaacgggcag
gaagtggttgataacactatctgttcatttaaaataggcgaagacaaacgggtgctctta
cctgttatggttcacttggacggttttcatctttctcatgttattgagcctattgagatg
cctgagagaaagcaggtagatgctttccttagtgttaacgactatccgtatgcactaaac
cctgataatccccgtgctatgggtgattttgcccccccggtgattttcaccgaagccaag
tgggcacaggaacaggattttcaaaaatccaaagctgttattttggaagtctggaaggac
tttgagaagcagtttggccgttcttacaaaccggtggaaacctatcgcaccgaaggtgct
gaaaacctgctgttcactatgggcagtttttcagagactgccatgtccgccattgataaa
atgcgtgatgacggcatgagtgtggggctggttcggcttcggctttggcgccccttcccc
tttgaggagttgcgcactgctgtcaaagatgccaaaaacctcatcgtgcttgatcgtgcc
ttgtcaataggtggtccgggtggtccggtctgttccgaaatcaaggccgctctatatcct
ctggagaaaaaacccaagattgtcagcattatcggcggtttgggtggacgggatataacc
gttgccaattttgaggatatcatgaagaaaggtctggcgattgctgaaaaaggcagtcct
aacgaatacgaaatatatggagtgagggcataa

DBGET integrated database retrieval system