KEGG   Dehalococcoides mccartyi CBDB1: cbdb_A717Help
Entry
cbdb_A717         CDS       T00273                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
deh  Dehalococcoides mccartyi CBDB1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:deh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    cbdb_A717 (tpiA)
   01230 Biosynthesis of amino acids
    cbdb_A717 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    cbdb_A717 (tpiA)
   00051 Fructose and mannose metabolism
    cbdb_A717 (tpiA)
   00562 Inositol phosphate metabolism
    cbdb_A717 (tpiA)
Enzymes [BR:deh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     cbdb_A717 (tpiA)
Exosome [BR:deh04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   cbdb_A717 (tpiA)
  Exosomal proteins of bladder cancer cells
   cbdb_A717 (tpiA)
  Exosomal proteins of melanoma cells
   cbdb_A717 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(582715..583476)
Genome map
AA seq 253 aa AA seqDB search
MRQIIIAGNWKMNTTLSEACTLVQSMKCELERIEGIEKIICPPFISLYPIKTILENSSIK
LGAQNLFYQEKGAYTGEISPLMLKELCQYVIIGHSERRAYFGETGQVVNQKIKAALQAGL
LPIVCVGEKPEENENGQTRQVLETQLKEALDGLNLSCIIIAYEPIWAIGTGKAATASEAN
SAIGYIRRVLGDTLGNAAAQTSPILYGGSVNEKNITEILSQTNIDGALVGGASLKAESFV
SICRQAAVIQNKH
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaggcagattattattgccggaaactggaaaatgaataccactctttccgaagcttgt
acacttgttcagagcatgaaatgcgaacttgagcggatagaaggcattgagaaaataatc
tgcccgccctttatatcgctgtatcccataaaaaccatactggaaaatagcagcatcaaa
ctgggtgctcaaaaccttttctaccaggaaaaaggggcttatacaggtgaaatatcccct
ctgatgctgaaagaactctgccaatacgttattataggccactctgaaagacgggcatat
ttcggtgaaacaggacaggtggtcaatcaaaagataaaggccgctcttcaggcaggccta
ctcccgatagtatgcgtgggcgaaaagcctgaagagaatgaaaacggccaaacccgccaa
gtgctggaaacccagctaaaagaggctctggacgggcttaacctcagctgtatcataata
gcctacgaacccatctgggcaatcggcaccggcaaggccgctaccgcttcagaagccaac
tctgccattggttatatccgccgggtgcttggtgatactctgggcaatgccgcagcccaa
acttctcctatactatatggcggcagtgtaaatgaaaaaaatattaccgaaattctttct
cagacgaatattgacggggctttggtgggtggcgcttctctaaaggctgaatcttttgta
agcatttgccgccaagccgccgttattcaaaataagcactaa

DBGET integrated database retrieval system