KEGG   Dehalococcoides sp. CBDB1: cbdb_B16Help
Entry
cbdb_B16          CDS       T00273                                 

Gene name
porG
Definition
pyruvic-ferredoxin oxidoreductase subunit gamma (EC:1.2.7.1)
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
deh  Dehalococcoides sp. CBDB1
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Class
Metabolism; Overview; Carbon metabolism [PATH:deh01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:deh00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:deh00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:deh00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:deh00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:deh00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:deh00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:deh00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
559100..559672
Genome map
AA seq 190 aa AA seqDB search
MKHFIEIRWHGRGGQGAVTSAELIAQAAIGKGKYAQAFPSFGPERRGAPVQSFNRISDNN
PIRERSGINQPDIVVVLDPSLVIIGNVISGLKDGGTLIINTTKPLEHFASQYGDRWKVAT
VDATAIAKEVLGVNIVNTTMLGALIKATGLADMEAFEEPLKHRFGKLAAKNMAAMKKAFE
ETVVKELKVG
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaaacattttattgaaatcagatggcatgggcgtggcggtcagggtgcggtaacctca
gctgagcttatcgcccaggcagcaatcggtaagggaaagtatgctcaggcattccccagt
ttcgggcctgaacgcagaggtgccccggttcaatctttcaatcgtatcagtgacaacaat
cccatccgtgaacgttcaggtatcaaccagccggatattgtggtggtgcttgaccccagt
ttggttatcatcgggaatgtaatctcaggtcttaaagatggtggcactcttattatcaac
accacaaagcctctggaacattttgcttctcaatacggtgatcgctggaaagtagccaca
gttgatgcaactgctattgccaaagaagtcttaggtgtcaatattgttaatacaaccatg
cttggcgcccttataaaggctaccggtctggcggatatggaagccttcgaagaaccttta
aaacaccgctttggaaagctggctgccaaaaatatggctgctatgaaaaaggcctttgaa
gagactgttgtaaaggagcttaaagttggctaa

DBGET integrated database retrieval system