KEGG   Dehalococcoides mccartyi CBDB1: cbdb_B16Help
Entry
cbdb_B16          CDS       T00273                                 

Gene name
porG
Definition
(RefSeq) pyruvic-ferredoxin oxidoreductase subunit gamma (EC:1.2.7.1)
  KO
K00172  
pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
deh  Dehalococcoides mccartyi CBDB1
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:deh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    cbdb_B16 (porG)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    cbdb_B16 (porG)
   00020 Citrate cycle (TCA cycle)
    cbdb_B16 (porG)
   00620 Pyruvate metabolism
    cbdb_B16 (porG)
   00640 Propanoate metabolism
    cbdb_B16 (porG)
   00650 Butanoate metabolism
    cbdb_B16 (porG)
  Energy metabolism
   00680 Methane metabolism
    cbdb_B16 (porG)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    cbdb_B16 (porG)
Enzymes [BR:deh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     cbdb_B16 (porG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
559100..559672
Genome map
AA seq 190 aa AA seqDB search
MKHFIEIRWHGRGGQGAVTSAELIAQAAIGKGKYAQAFPSFGPERRGAPVQSFNRISDNN
PIRERSGINQPDIVVVLDPSLVIIGNVISGLKDGGTLIINTTKPLEHFASQYGDRWKVAT
VDATAIAKEVLGVNIVNTTMLGALIKATGLADMEAFEEPLKHRFGKLAAKNMAAMKKAFE
ETVVKELKVG
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaaacattttattgaaatcagatggcatgggcgtggcggtcagggtgcggtaacctca
gctgagcttatcgcccaggcagcaatcggtaagggaaagtatgctcaggcattccccagt
ttcgggcctgaacgcagaggtgccccggttcaatctttcaatcgtatcagtgacaacaat
cccatccgtgaacgttcaggtatcaaccagccggatattgtggtggtgcttgaccccagt
ttggttatcatcgggaatgtaatctcaggtcttaaagatggtggcactcttattatcaac
accacaaagcctctggaacattttgcttctcaatacggtgatcgctggaaagtagccaca
gttgatgcaactgctattgccaaagaagtcttaggtgtcaatattgttaatacaaccatg
cttggcgcccttataaaggctaccggtctggcggatatggaagccttcgaagaaccttta
aaacaccgctttggaaagctggctgccaaaaatatggctgctatgaaaaaggcctttgaa
gagactgttgtaaaggagcttaaagttggctaa

DBGET integrated database retrieval system