KEGG   Delftia sp. Cs1-4: DelCs14_0132Help
Entry
DelCs14_0132      CDS       T01497                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
del  Delftia sp. Cs1-4
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
141361..142308
Genome map
AA seq 315 aa AA seqDB search
MNLSDGLSLVQHSEQAAATGLDSICVTEHEFVMPGTGAAARTGVLLVHGLTGTPAEMRLL
AKGLNKQGFTVYAVQLAGHCGSMEDLVDTRWTDWLASVEAGLQRLSQHMDHVVVGGLSMG
AVLSLAVAQRHPDKVDGVCALSTTFRYDGWSIPFYTRLAFLLPLFRALGIGRHSVFMEQP
PYGIKDEALRARVVEQMHSGDSAAAGLPGNPWWSIIELRRLSAHVLARLPQLRSPCLVIH
ARNDDISSVANAHDIVHGASQAHVELVLLDNSYHMVTIDRDRRTVIARTTEFVARIASGA
APREVRAAEAARHGQ
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgagtgatgggctctccttggttcagcacagcgagcaggctgctgccacgggg
ctggacagcatctgcgtgaccgagcatgaattcgtcatgcccggcacgggcgctgccgcg
cgcaccggcgtgctgctggtgcacgggctcacgggcacgccggccgagatgcgcctgctg
gccaaggggctgaacaagcagggcttcaccgtctatgcggtccagctggccggccattgc
ggcagcatggaagatctcgtggacacgcgctggaccgactggctggccagcgtggaggcc
gggctgcagcgactgtcgcagcacatggaccatgtggtggtcggcggcctgtccatgggc
gccgtgctctccctggccgtggcccagcgccaccccgacaaggtggacggcgtctgcgcc
ctgtccaccaccttccgctacgacggctggagcattcccttctacacgcgcctggccttc
ctgctgccgctgttccgcgcgctgggcattggccgccacagcgtgttcatggagcagccg
ccctacggcatcaaggacgaggccctgcgcgcgcgcgtggtcgagcaaatgcattcgggc
gacagcgcggcggccggcctgccgggcaatccctggtggtccatcatcgagctgcgccgc
ctctcggcccatgtgctggcgcgcctgccccagctgcgctcgccctgcctggtcatccat
gcgcgcaacgacgacatctcgtcggtggccaacgcccatgacatcgtgcatggcgccagc
caggcccatgtcgagctggtgctgctggacaacagctaccacatggtcaccatcgaccgc
gaccgccgcaccgtgatcgcgcgcaccaccgaattcgtggcgcgcatcgccagcggtgcc
gccccccgcgaggtgcgggctgcggaggccgcgcggcatgggcagtga

DBGET integrated database retrieval system