KEGG   Delftia sp. Cs1-4: DelCs14_0185Help
Entry
DelCs14_0185      CDS       T01497                                 

Definition
alcohol dehydrogenase zinc-binding domain-containing protein
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
del  Delftia sp. Cs1-4
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:del00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    DelCs14_0185
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DelCs14_0185
  Lipid metabolism
   00071 Fatty acid degradation
    DelCs14_0185
  Amino acid metabolism
   00350 Tyrosine metabolism
    DelCs14_0185
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    DelCs14_0185
   00626 Naphthalene degradation
    DelCs14_0185
Enzymes [BR:del01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     DelCs14_0185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
208042..209172
Genome map
AA seq 376 aa AA seqDB search
MKTRAAVLTRTGAAAPYADSRPLEIWEVDLAPPGPGEVLVKVAAAGVCHSDLSIINGDRP
RDTPIVLGHEAAGVIQALGEGVTDLEVGDHVVMLFVPGCGNCQPCAEGRPVLCEPAGQAG
VAGTLLSGARRLSRNGQPISHFVGVSAFAEHAVLSRRGVHRIDKSVPLELAALFGCAVMT
GVGAVANTARVSPGQSVAVVGLGGVGLSSVMGAAAAGASRVVAVDLNADKLAMARDFGAT
DTVNAGDEDAVKQVRELTGGGVDHAFEMVGSAKALEMAYRITRRGGQTVTAGLPSSAQAI
SLPVWHLVAEERTLKGCYMGSCVPRRDIDRYLALHAAGRLPVDRLVTGHLTLDQINEGFD
RLARGEAIRQIIRMEA
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaagacacgcgccgccgtactcacgagaacgggcgcagccgcgccctatgccgacagc
cgcccgctggagatctgggaggtggacctggcgccgcccggccccggcgaggtgctggtc
aaggtggccgccgcaggcgtgtgccactccgacctgtccatcatcaacggcgaccgtccg
cgcgacacgcccatcgtgctcggccatgaggccgcaggcgtgatccaggcgctgggcgag
ggcgtgaccgacctggaggtgggcgaccacgtggtcatgctcttcgtgcccggctgcggc
aactgccagccctgcgccgaaggccggccggtgctctgcgagcccgcaggccaggccggc
gtggcgggcacgctgctgtcgggtgccaggcgcctgtcgcgcaatggccagcccatctcg
cacttcgtcggcgtctcggcctttgccgagcatgccgtgctctcgcgccgcggcgtgcac
cgcatcgacaagtcggtgccgctggagctggccgcgctgttcggctgcgccgtgatgacc
ggcgtgggcgccgtggccaataccgccagggtgagccccggccagagcgtggccgtggtg
gggctgggcggcgtgggcctgtcctcggtgatgggcgcggcggcggcgggcgcgtcccgc
gtggtggccgtggacctcaatgccgacaagctggccatggcgcgcgatttcggcgccacc
gacaccgtcaatgccggcgacgaggatgccgtcaagcaggtgcgcgagctgacgggcggc
ggcgtggaccatgccttcgagatggtgggctcggccaaggcactggagatggcctaccgc
atcacgcggcgcggcggccagaccgtgacggcgggcctgccctccagcgcccaggccatc
agcctgccggtctggcacctggtggcagaggagcgcacgctcaagggctgctacatgggc
agctgcgtgccgcgccgcgacatcgaccgctacctggccctgcatgcggccggcaggctg
cccgtggaccgcctggtcaccggccacctgacgctggaccagatcaacgagggcttcgac
cgcctggcgcgtggcgaggccatacgccagatcatccgcatggaggcctga

DBGET integrated database retrieval system