KEGG   Delftia sp. Cs1-4: DelCs14_0466Help
Entry
DelCs14_0466      CDS       T01497                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
del  Delftia sp. Cs1-4
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:del00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    DelCs14_0466
Enzymes [BR:del01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     DelCs14_0466
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
507523..509703
Genome map
AA seq 726 aa AA seqDB search
MSPRPRSRTVDTATLDLFDERPGGEPPGDDSPGGKPPGAVPPDTNELLALLRRWADAGLL
RRLDAALASFVAGQDAQAGPALLVAAALLAQMEGRGHSCLPLAPLAGHPNDVLAWPAEAL
PAQQALWQMLPARLSGWVAALGASPVVRVIGDAGQDGGEDLGQPLVLAGADGPAPLLYLR
RYWDYERAVATHVIQRTAAQAVAGQPLDEALARHWLDRLFPPAAEGGPVDWQKLACALAL
RGRLSVITGGPGTGKTYTAARLLALLFATAPDAGQLRVALAAPTGKAAARLKQSIDGALL
QLQGSMGGEIDLAGLVQRMGAARTLHSMLGARPDTRHWGFHAGRQLDVDVLIVDEASMVH
LEMMAALLEALPAGARLVLLGDKDQLASVEAGAVLGDLCRDAQAGRYLPDTLDYALHVAG
QAVPPQFAAPAGDRPPALAQHTVMLRESRRFGGPIGQLARAVNAGHAAQAQALLDAGTQG
GTHSELWERQGGGVQAVTELAVRGRGGLASYALYAGALQNRPAADGDYEAAHRAWVVDVL
QAFERFRLLCAVREGDWGVSGLNRAVEQALEAQGAIRRSGEWYAGRPVMVTRNDAQLGVF
NGDIGIALPGGSQGGSQGAPQGGPVQPLRVYFLQGDELRSVGVSRLAHVETAFAMTVHKS
QGSEFEHTALVLPSRGGSVLGRELVYTGITRARQAFSLFSEVPGLLASAVGSPTQRASGL
LRWLQD
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgagcccgcgcccccgttcgcggaccgtcgatacggccacgctggacctgttcgacgaa
cggccgggcggcgaaccgccgggcgacgactcgccgggcggcaaaccgccgggcgccgtg
ccgccagacaccaatgaactgctggccctgctgcgccgctgggccgatgccggcctgctg
cggcgcctggatgcggcgctggcttccttcgtcgccgggcaggatgcgcaggccgggccc
gccttgctggtggccgccgcgctgctggcgcagatggaggggcgcggtcacagctgcctg
cccctggcaccgctggccggccaccccaacgacgtgctggcctggcccgccgaggcgctg
cccgcgcagcaggccctgtggcagatgctgcccgcgcgcctgtccggctgggtggcggcg
ctgggtgccagccccgtggtgcgtgtgatcggcgacgcgggccaggatggcggcgaggac
cttggccagcccctggtgctggccggtgccgacggccccgcgcctctgctgtacctgcgc
cgctactgggactacgagcgcgccgtggccacccatgtcatccagcgcacggcggcgcag
gccgtggccggccagccgctggacgaagccctggcccgccactggctggaccgcctgttc
ccccctgcggcggaaggcggccccgtggactggcagaagctggcctgcgcgctggcgctg
cgcggccggctgtcggtgatcacgggcggccccggcaccggcaagacctataccgcggcg
cggctgctggccctgctgtttgccacggcgcccgacgccggccaactgcgcgtggccctg
gccgcgcccacgggcaaggcggctgcgcgcctgaagcaatcgattgacggggccttgctg
caattgcagggcagcatgggcggcgagatcgacctggcgggcctggtgcagcgcatgggc
gcggcgcgcaccctgcactccatgctgggcgcgcggcccgatacgcggcactggggattc
catgcgggccggcagctggacgtggacgtgctcatcgtcgatgaggcctccatggtccac
ctggagatgatggcggcgctgctggaggcactgccggccggcgcccgcctggtgctgctg
ggcgacaaggaccagctggcatcggtggaggcgggcgccgtgctgggcgacctgtgccgc
gatgcccaggccggacgctacctgccggacacgctggactacgcgctgcacgtggccggc
caggcggtgccgccgcagttcgcggcgccggcaggcgaccggcctccggctcttgcgcag
cacaccgtcatgctgcgcgaaagccggcgcttcggtggccccatcggccagttggcgcgc
gccgtgaatgccggccatgccgcgcaggcccaggccctgctcgatgccggcacgcaaggc
ggtacgcactccgaactctgggagcgccagggcggcggcgtgcaggccgtgaccgaactg
gccgtgcgcgggcgtggcggcctggccagctatgcgctgtatgccggggcgctgcaaaac
aggccggctgcggacggcgactacgaggccgcgcaccgggcctgggtggtcgatgtgctg
caggccttcgagcgcttccggctgctgtgcgccgtgcgcgagggggactggggcgtgtcc
ggcctcaaccgggcggtggagcaggccctggaagcgcagggcgcgatccgccgcagcggc
gaatggtatgcgggccggcccgtcatggtcacgcgcaacgatgcgcagctgggcgtgttc
aacggtgacatcggcattgcgctgccgggtgggtcgcagggcgggtcacagggggccccg
cagggtgggcccgtgcagccgctgcgcgtgtacttcctgcagggtgacgagctgcgctcg
gtcggtgtcagccgcctggcccatgtggagaccgccttcgccatgacggtgcacaaaagc
cagggctcggagttcgagcacacggccctggtgctgccctcgcgcggcggcagcgtgctg
gggcgcgagctggtctacaccggcatcacgcgcgcccgccaggccttctcgctgttctcc
gaggtgccgggcctgctggcctcggccgttggcagccccacgcagcgcgccagcgggctg
ctgcgctggctgcaggactga

DBGET integrated database retrieval system