KEGG   Delftia sp. Cs1-4: DelCs14_0597Help
Entry
DelCs14_0597      CDS       T01497                                 

Definition
response regulator receiver modulated CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
del  Delftia sp. Cs1-4
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:del00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    DelCs14_0597
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    DelCs14_0597
Enzymes [BR:del01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     DelCs14_0597
Two-component system [BR:del02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   DelCs14_0597
Bacterial motility proteins [BR:del02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    DelCs14_0597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
659216..660349
Genome map
AA seq 377 aa AA seqDB search
MDRKIRVIVVDDSALVRSLLSEIINRQHDMECIGSANDPLIAREMIREMNPDVITLDVEM
PRMDGIDFLGRLMRLRPMPVVMISTLTERGAEVTMRALELGAIDFVAKPRVGVSNGLQEL
AAQIVDKIRVAAVAQVRRLPVAPRSAASAAGSAAAPVASSAGSAVPRQAAPTSLLGRLST
EKLVAIGASTGGTEAIREVLTHLPADCPAIVITQHMPPGFTTSFAARLNSLCQMTVKEAQ
HGERLLPGHAYIAPGGKHFSVQRSGANYVAVVDDSPPVNRHKPSVEVLFKSVAACAGRNA
YGIMLTGMGADGAVAMREMRDAGSYNLVQDEASCIVFGMPREAIAHGAADEVLPLNQIAA
ALLGKLRIGSDQVHHRI
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggacaggaaaatcagggtgatcgtggtggacgactctgcgctggtgcgcagtctgctg
tccgagatcatcaatcgccagcacgacatggaatgcatcggctcggccaatgacccgctg
atcgcacgcgaaatgattcgcgagatgaatcccgacgtgatcacgctcgatgtggaaatg
ccgcgcatggatggcatcgacttcctgggccggctcatgcgcctgcgtcccatgccggtg
gtcatgatctccacgctgaccgaacgcggcgccgaggtcaccatgcgcgcactggaactg
ggcgccatcgacttcgtggccaagccgcgcgtgggtgtctccaacggcctgcaggaactg
gccgcgcagatcgtggacaagatccgcgttgctgccgtggcccaggtacggcgtctgccg
gtcgctccccgcagtgcagcctctgccgcaggcagcgcggcagcgccggtcgcttcctct
gcgggttcggccgtgccgcgccaggctgcaccgacgtcgctgctggggcggctttccacg
gagaagctggttgccatcggcgcctccacgggcggcaccgaggccatccgcgaagtgctc
acccatctgccggccgactgcccggccatcgtcatcacccagcacatgccgccgggcttc
accaccagcttcgcggcccggctcaacagcctgtgccagatgaccgtgaaggaagcgcag
cacggcgagcgcctgctgcccggtcacgcctatatcgccccgggtggcaagcatttctcc
gtgcagcgcagcggcgccaactatgtcgccgtggtcgatgacagcccgccggtgaatcgc
cacaagccttcggtcgaagtgctgttcaagtcggtggccgcctgcgcgggccgcaacgcc
tacggcatcatgctcaccggcatgggcgccgatggtgcggtcgccatgcgcgaaatgcgc
gatgcaggcagctacaacctcgtgcaggacgaggccagctgcatcgtcttcggcatgccg
cgcgaggccatcgcccacggcgctgccgacgaagtgctgcccctcaaccagatcgccgcc
gccttgctgggcaagctgcgcataggttcggaccaggtgcaccaccgcatctga

DBGET integrated database retrieval system