KEGG   Delftia sp. Cs1-4: DelCs14_0855Help
Entry
DelCs14_0855      CDS       T01497                                 

Definition
magnesium chelatase (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
del  Delftia sp. Cs1-4
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:del00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DelCs14_0855
Enzymes [BR:del01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     DelCs14_0855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
966946..968091
Genome map
AA seq 381 aa AA seqDB search
MTASPDLGSGAQPALPPLFPFAAIAGQPLLCQALLLAAIDPQLGGVLIEGPRGTAKSTAA
RALAELIDAAPFVTLPLGASLEHLAGSLDLGQAMAGHALKFAPGLLARAHGGVLYVDEIN
LLPDALVDVLLDAAASGVNVVERDGISHRHAARFVLVGTMNPEEGQLRPQLLDRLGLCVR
LANVQDAAQRQAIVRARLLFDADPAAFRARHADAQAALAAQLRTARERLQPAGALPWSDA
VLQAAGALCIAAQVDGLRADLVLLRAARAWAAWLGDAEVRPDHVQAVAELVLVHRRKPGA
PQPPQQQQPSPQQAPSNPPSQSPAQSRPPAESTANGAGDSPPSEADWGAMPPEPVGLLRV
AVPSLLAREAAKAGAPATKKA
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcctcccctgacctgggcagcggcgcccagcccgcgctgccgccgctgtttccc
tttgccgccatcgccggccagcccctgctgtgccaggcgctgctgctggccgccatcgac
ccgcaactgggcggcgtgctgatcgaggggccgcgcggcacggccaaatccacggccgcg
cgtgcgctggccgagctcatcgatgccgcgcccttcgtcacgctgccgctgggcgcttcg
ctggagcatctggccggctcgctggacctgggccaggccatggccggccatgcgctcaaa
ttcgcgcccggcctgctggcgcgcgcccatggcggcgtgctctatgtggacgagatcaac
ctgctgcccgatgccctggtcgatgtgctgctggatgccgccgccagcggcgtcaacgtg
gtcgagcgcgacggcatctcgcaccgccacgcggcgcgcttcgtgctggtgggcaccatg
aaccccgaggaaggccaactgcgcccgcagctgctggaccgcctgggcctgtgcgtgcgc
ctggccaatgtgcaggatgcggcccagcgccaggccatcgtgcgcgcgcggctgctgttc
gatgccgacccggccgccttccgcgcccgccatgcagacgcccaggccgcgctggctgcc
cagctgcgcacggcacgcgagcgcctgcagccggccggcgcgctgccctggtccgacgcg
gtgctgcaggccgccggagcgctgtgcattgccgcccaggtggacggcctgcgggccgac
ctggtgctgctgcgcgccgcccgcgcctgggccgcctggctgggcgatgccgaggtcagg
cccgaccatgtgcaggccgtggccgagctggtgctggtgcaccgccgcaagccgggggcg
ccgcagccgccgcagcagcagcagccatccccacagcaagcgccatcgaatccgccttcg
cagtcgccggcacaaagccggccgcctgcggaatccacggccaacggcgcaggcgacagc
ccgccctccgaggccgactggggcgccatgccgcccgagcccgtgggcctgctgcgtgtc
gccgtgccctcattgctggcccgcgaggccgcaaaggcgggagcgcccgccacaaaaaaa
gcctga

DBGET integrated database retrieval system