KEGG   Delftia sp. Cs1-4: DelCs14_1047Help
Entry
DelCs14_1047      CDS       T01497                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
del  Delftia sp. Cs1-4
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:del00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:del00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:del02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1192692..1194209
Genome map
AA seq 505 aa AA seqDB search
MHPILQKTSLALAAAGALALLAPAAHAAGEAKNVIFFLGDGMGPVTVTAARIYKGEKQLA
ANPTALTSSERATLTMQSLPYASRVKTFSRDGQTTDSAPSMAAYMTGVKMNNEVISMSAE
TLAYAANGQQYINGEDTTCPAGNGQPAQTLLELSKAKGRAVGAISTTRVGHATPAATYAH
ICNRNGYNSIAEQSVPGHANYNAKLGDGIDVLMGGGQRNYLPKSVNPSSKRTDTANLVDM
MKAKGYAYVAKGSELSALDATKAPKLLGLFTQSEMAYELDRVKQKLDEPSLSDMTGKALD
VLSRNDKGFFLMVEGGRIDHALHGTNAKRALEDTLAFDRAIETAMAYMEKKDPGLKNTLI
VVTADHDHNMVFNGYSKIGNPILGKVQDYQTGQMAKAQDGKPYTTLAFGNGGRPNATASS
QVNAEDGNKPWIAPTRGASRDDVTAVDTTDDNYLQEVGLNLGTPGSETHGGGDVMLFAGG
AGAKIFKGTMDNTKVFSKVREAAGL
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgcatccgatcctccaaaagacctccctcgccctggctgcggccggcgcgctggcgctg
ctggcacctgccgcccatgcggctggcgaggccaagaacgtcattttcttcctcggcgac
ggcatgggcccggtcaccgtgaccgccgcgcgcatctacaagggtgagaagcagctggct
gccaatcccacggcactgaccagcagcgagcgcgccacgctgaccatgcagtccctgcct
tacgccagccgcgtcaagaccttctcgcgcgatggacagaccacggacagcgcgccttcg
atggcggcctacatgaccggcgtgaagatgaacaacgaagtcatctccatgtcggccgag
accctggcctatgcggccaacggccagcagtacatcaacggtgaggacaccacctgcccg
gccggcaacggccagcccgcgcagaccctgctggaactgtccaaggccaagggccgtgcc
gtgggcgccatctccaccacgcgcgtgggccatgcgacgcctgcggccacctacgcccac
atctgcaaccgcaatggctacaacagcattgccgagcagtccgtgcccggccatgccaac
tacaacgccaagctgggcgacggcatcgacgtgctcatgggcggcggccagcgcaactac
ctgcccaagtcggtcaaccccagcagcaagcgcacggacacggccaacctcgtggacatg
atgaaggccaaaggctacgcctatgtcgccaagggcagcgagctgtcagccctggacgcg
accaaggcccccaagctgctgggcctgttcacgcaaagcgaaatggcctacgagctggac
cgcgtcaagcaaaagctggacgagcccagcctgtccgacatgaccggcaaggcgctggac
gtgctcagccgcaatgacaagggcttcttcctgatggtggaaggcggccgcatcgaccac
gcactgcacggcaccaatgccaagcgcgcgctggaggacacgctggccttcgaccgcgcc
atcgagaccgccatggcctacatggaaaagaaggacccgggcctgaagaacacgctgatc
gtcgtcacggccgatcacgaccacaacatggtgttcaacggctactccaagatcggcaat
cccatcctgggcaaggtgcaggactaccagaccggccagatggccaaggcccaggacggc
aagccctacaccacgctggccttcggcaacggcggacgtcccaacgccaccgcctccagc
caggtcaatgccgaagatggcaacaagccctggatcgctcccacgcgcggcgcctcgcgc
gacgacgtgacggccgtggacaccacggacgacaactacctgcaggaagtcggcctgaac
ctgggcacgccgggctccgagacccatggcggcggcgacgtgatgctgttcgccggcggc
gcgggcgccaagatcttcaagggcacgatggacaacaccaaggtgttctccaaggtccgc
gaagccgctggcctgtaa

DBGET integrated database retrieval system