KEGG   Delftia sp. Cs1-4: DelCs14_1087Help
Entry
DelCs14_1087      CDS       T01497                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
del  Delftia sp. Cs1-4
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:del00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:del00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1236939..1238207
Genome map
AA seq 422 aa AA seqDB search
MDKLLIRGGRALHGEVTVSGAKNAALPELCAALLSSEPVTLRNVPRLQDVATMLKLIRNM
GVSAEHDDSGTVRINAGSLSNPEAPYELVKTMRASVLALGPLLARFGQARVSLPGGCAIG
SRPVDQHIKGLQAMGAEIVVENGYMNACLPGHLKRLQGARITTDMVTVTGTENFLMAAVL
AEGETVLENAAMEPEIGDLAEMLIKMGARIEGHGTGRIVIQGVERLGGCEHQVVADRIEA
GTFLCAVAATGGNALLRNGRADHLGAVIDKLKDAGAEVSAEDGGIRVRAAGKLKAQSFRT
TEYPGFPTDMQAQFMALNLVAEGCSMVTETIFENRFMHVDEMLRLGAQITTDGRVATITG
SQSLSGAAVMATDLRASASLVIAGLVAKGETLVDRIYHLDRGYDRMEDKLRGLGADIERV
SQ
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggacaaactcctgattcgcggtggccgagcgctgcatggcgaggtgacggtctccggc
gccaagaatgccgccttgcccgagctgtgcgccgcgctgctgtcgtccgagcccgtcacc
ctgcgcaacgtgccgcgcctgcaggacgtggccaccatgctcaagctcatccgcaacatg
ggtgtcagcgccgagcacgatgacagcggcaccgtgcgcatcaacgccggctctctgtcc
aaccccgaggcaccctacgaactggtcaagaccatgcgcgcctcggtcctggccctgggc
ccgctgctggcccgattcggccaggcccgcgtgtcgctgcccggcggctgcgccatcggc
tcgcgccccgtggaccagcacatcaagggcctgcaggccatgggcgccgagatcgttgtc
gagaacggctacatgaacgcgtgcctgcccgggcatctcaagcgcctgcagggcgcccgc
atcaccaccgacatggtgaccgtcacgggcaccgagaacttcctgatggccgccgtgctg
gccgaaggcgagaccgtgctggaaaacgccgccatggagcccgagatcggcgacctggcc
gaaatgctcatcaagatgggcgcaagaattgaaggccatggcaccggccgcatcgtcatc
cagggcgtggagcgcctgggcggctgcgagcaccaggtggtggccgaccgcatcgaggcc
ggcacctttttgtgcgccgtggccgcaacgggcggcaatgcgctgctgcgcaatggccgc
gccgaccatctgggcgccgtcatcgacaagctcaaggatgcgggcgctgaggtgtccgcc
gaggacggcggcatccgcgtgcgcgcggcgggcaagctcaaggcccagagtttccgcacc
accgaatacccgggctttcccaccgacatgcaggcgcagttcatggcgctgaacctggtg
gccgaaggctgcagcatggtcaccgagaccatcttcgagaaccgcttcatgcacgtggac
gaaatgctgcgcctgggcgcgcagatcaccaccgacgggcgcgttgccaccatcaccggc
agccagtcgctgtcgggcgcggccgtcatggccaccgacctgcgcgcttcggccagcctg
gtcatcgccggcctcgtggccaagggcgagaccctggtcgatcgcatctatcatctggac
cgcggctacgatcgcatggaagacaagctgcgcggcctgggtgccgacatcgaaagagtt
tcccaatga

DBGET integrated database retrieval system