KEGG   Delftia sp. Cs1-4: DelCs14_1127Help
Entry
DelCs14_1127      CDS       T01497                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
del  Delftia sp. Cs1-4
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:del00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DelCs14_1127
  Amino acid metabolism
   00330 Arginine and proline metabolism
    DelCs14_1127
Enzymes [BR:del01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     DelCs14_1127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1276825..1277973
Genome map
AA seq 382 aa AA seqDB search
MSSNLLRDAHRIVVKVGSSLVTNEGRGLDEAAIQEWSRQLAALVRGDESHGGQRREVIMV
SSGAVAEGMKRLGWAARPKEIHELQAAAAVGQMGLIQMYESKLREQGMGSAQVLLTHADL
ADRERYLNARNTLLTLLELGIVPVINENDTVVNDEIKFGDNDTLGALVANLIEADALVIL
TDQRGLYSADPRSNPDARFIDVANAGDPALEEMAGGAGSSIGKGGMITKILAAKRAAGSG
ASTVIAWGREQDVLVRLAAGESIGTLLVAQTHKNQARKQWIADHLQLRGSVSVDAGAVAK
LRDEGKSLLPIGMVNVDGEFARGDVIAVRDALGIEVARGLANYASAEARLLCRKSSVEIE
RLLGYSAGPEMVHRDNMVIAGH
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccaacttgttgcgtgatgcccatcgcatcgtggtcaaggtcggctccagcctg
gtgaccaatgaaggtcgcggtcttgatgaggccgccatccaggagtggagccgccagctg
gcggccctggtgcgcggggatgagagccatggcggtcagcggcgcgaggtgatcatggtc
tccagcggcgcggtggctgaaggcatgaagcgccttggctgggccgcgcggcccaaggag
atccatgagctgcaggccgccgcagccgtgggccagatggggctgatacagatgtatgag
tccaagctgcgcgagcagggcatgggcagtgcccaggtgctgctcacgcatgccgacctg
gcggaccgcgagcgctatctgaatgcgcgcaacaccttgctgacgctgctggagctgggc
atcgtgccggtgatcaacgagaacgacaccgtggtcaacgatgagatcaagttcggcgac
aacgacaccctgggtgctttggtggccaacctgatcgaagccgatgccctggtcatcctg
accgatcagcgaggcctttacagcgccgatccgcgcagcaatcccgatgcgcgtttcatc
gacgtggcaaatgccggcgatcctgcactggaggagatggcgggcggcgcgggctcgtcc
atcggcaagggtgggatgatcaccaagatcctcgcagccaagcgtgcggcgggctcgggt
gcttcaaccgtcatcgcctggggccgtgaacaggacgtgctggtgcgtctggctgcgggc
gagtccattggcacgctgctcgtggcgcagacccacaagaaccaggcgcgcaagcagtgg
attgccgaccatctgcagctgcgcggctccgtgtccgtggatgccggcgccgtggccaag
ctgcgcgacgaaggcaagagcctgctgcccatcggcatggtgaatgtggatggcgaattc
gcccgcggcgatgtgattgccgtgcgcgatgcgctgggcatcgaggtggcgcgtggtctg
gccaactatgcaagtgccgaggcgcgcctgctttgtcgtaagagctcggtggagatcgag
cgcctgctgggctattccgcaggcccggagatggtgcaccgcgacaacatggtgattgcc
gggcactga

DBGET integrated database retrieval system