KEGG   Delftia sp. Cs1-4: DelCs14_1161Help
Entry
DelCs14_1161      CDS       T01497                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
del  Delftia sp. Cs1-4
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:del00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    DelCs14_1161
Enzymes [BR:del01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     DelCs14_1161
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1316420..1317142
Genome map
AA seq 240 aa AA seqDB search
MFRELVDMKQDSQAEGTPVSVKIRERLKQAQKRFHANDNISEFIEPGELELLLDEVQDKM
QGVLDSMVIDTTHDHNTRATARRVAKMYVNEVFRGRYVAQPAITEFPNAEHLNELMIVGP
ITVRSACSHHLCPVIGKIWIGVLPNKNTNVIGLSKYARLVDWIMGRPQIQEEAIIQLADL
ILDKTRPDGLAVVMEASHFCMSWRGVREMDSKMLNSVMRGAFLTNPELRREFLSLVSSRR
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgttcagagaactcgtcgacatgaaacaagacagccaggccgagggcacccccgtctcg
gtcaagatccgcgaacggttgaagcaggcgcaaaagcgctttcatgcgaacgacaacatc
tccgaattcatcgagcccggtgaactcgagctgctgctcgacgaagtccaggacaagatg
cagggcgtgctcgacagcatggtcatcgacaccacgcacgaccacaacacgcgcgccacg
gcgcgccgcgtggccaagatgtatgtcaacgaggtgttccgcggccgctacgtggcgcag
cccgccatcaccgagttccccaacgccgagcacctcaacgagctgatgatcgtcggcccg
atcacggtgcgcagcgcctgcagccaccatctgtgcccggtgatcggcaagatctggatc
ggcgtgctgcccaacaagaacaccaatgtcatcggcctgtccaagtacgcgcggctggtg
gactggatcatgggccgcccccagatccaggaagaggccatcatccagctggccgacctg
atcctcgacaagacccgccccgacggcctggccgtggtcatggaggcttcgcacttctgc
atgtcctggcgcggcgtgcgcgagatggacagcaagatgctgaactccgtcatgcgcggc
gccttcctcaccaatcctgaactgcgccgcgagtttctctcgctggtgtccagccgcagg
taa

DBGET integrated database retrieval system