KEGG   Delftia sp. Cs1-4: DelCs14_1161Help
Entry
DelCs14_1161      CDS       T01497                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
del  Delftia sp. Cs1-4
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:del00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1316420..1317142
Genome map
AA seq 240 aa AA seqDB search
MFRELVDMKQDSQAEGTPVSVKIRERLKQAQKRFHANDNISEFIEPGELELLLDEVQDKM
QGVLDSMVIDTTHDHNTRATARRVAKMYVNEVFRGRYVAQPAITEFPNAEHLNELMIVGP
ITVRSACSHHLCPVIGKIWIGVLPNKNTNVIGLSKYARLVDWIMGRPQIQEEAIIQLADL
ILDKTRPDGLAVVMEASHFCMSWRGVREMDSKMLNSVMRGAFLTNPELRREFLSLVSSRR
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgttcagagaactcgtcgacatgaaacaagacagccaggccgagggcacccccgtctcg
gtcaagatccgcgaacggttgaagcaggcgcaaaagcgctttcatgcgaacgacaacatc
tccgaattcatcgagcccggtgaactcgagctgctgctcgacgaagtccaggacaagatg
cagggcgtgctcgacagcatggtcatcgacaccacgcacgaccacaacacgcgcgccacg
gcgcgccgcgtggccaagatgtatgtcaacgaggtgttccgcggccgctacgtggcgcag
cccgccatcaccgagttccccaacgccgagcacctcaacgagctgatgatcgtcggcccg
atcacggtgcgcagcgcctgcagccaccatctgtgcccggtgatcggcaagatctggatc
ggcgtgctgcccaacaagaacaccaatgtcatcggcctgtccaagtacgcgcggctggtg
gactggatcatgggccgcccccagatccaggaagaggccatcatccagctggccgacctg
atcctcgacaagacccgccccgacggcctggccgtggtcatggaggcttcgcacttctgc
atgtcctggcgcggcgtgcgcgagatggacagcaagatgctgaactccgtcatgcgcggc
gccttcctcaccaatcctgaactgcgccgcgagtttctctcgctggtgtccagccgcagg
taa

DBGET integrated database retrieval system