KEGG   Delftia sp. Cs1-4: DelCs14_1359Help
Entry
DelCs14_1359      CDS       T01497                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
del  Delftia sp. Cs1-4
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:del00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    DelCs14_1359
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    DelCs14_1359
Enzymes [BR:del01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     DelCs14_1359
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1541940..1543031
Genome map
AA seq 363 aa AA seqDB search
MTEHAPLIIDIAGKALTDVDRQRLAHPLVGGIILFARNWESRDQLVQLCADIKAVKPDLL
ICVDHEGGRVQRFRADGFTHLPPMRAFGQMWMDDGKGSKHREGSGALAAMNAATAAGYVL
GTELRACGVDFSFTPVLDLDYGASSVIGDRSFHRDPRVVAALARSLMHGLLQAGMGNCGK
HFPGHGFVKADSHVDIPVDGRSLTAILGEDAAPYPWLSSVLTAVMPAHVIYPKVDKRPAG
FSAKWLKDILRSRLRYDGAIFSDDLSMEGARRIDGQLIGYTDAALAALEAGCDMVLLCNQ
SLGLGEHVDELLAGMEVAQRSGRWQPDADSESRRVALLPETVPQPWDDLMRQPAYLQALD
LLP
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagcacgcacccctcatcatcgacatcgccggcaaggcactcaccgatgtggat
cgccagcgcctggcgcatccgctggtcggcggcatcatcctctttgcccgcaactgggaa
agccgcgaccagctggtgcagctgtgcgccgatatcaaggcggtcaagcccgatttgctg
atctgcgtggaccatgagggcgggcgcgtgcagcgttttcgcgctgacggcttcacgcac
ctgccgcccatgcgcgccttcggccagatgtggatggacgacggcaagggcagcaagcac
cgtgaaggcagcggcgccctggccgccatgaatgccgccacggcggccggctacgtgctg
ggcaccgagctgcgtgcctgcggcgtggatttcagcttcaccccggtgctggaccttgac
tacggtgccagcagcgtcatcggcgaccgcagcttccaccgcgacccgcgcgtggtggct
gcgctggcccgcagcctcatgcacggcctgctgcaggcaggcatgggcaactgcggcaag
cactttcccggccacggcttcgtcaaggccgattcgcatgtggacattccggtcgatggc
cgcagcctcaccgccatcctgggcgaggacgccgcgccctatccctggctgtccagcgtg
ctcacggccgtgatgccggcccatgtgatctaccccaaggtggacaagcgcccggccggt
ttttccgccaagtggctcaaggacatcctgcgcagccgcctgcgctacgacggcgccatc
ttcagcgacgacctgagcatggagggcgcgcgccgcatcgacggccagctcatcggctac
accgacgcggcgctggccgcgctggaggcgggctgcgacatggtgctgctgtgcaaccag
agcctgggcctgggcgagcatgtggacgagctgctggccggcatggaggtcgcgcagcgc
agcggccgctggcagcccgatgccgacagcgaatcgcgccgcgtggccctgctgccggag
accgtgccccagccctgggacgacctcatgcgccagcctgcctatctgcaggcgctggac
ctgctgccttga

DBGET integrated database retrieval system