KEGG   Delftia sp. Cs1-4: DelCs14_1372Help
Entry
DelCs14_1372      CDS       T01497                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
del  Delftia sp. Cs1-4
Pathway
del00260  Glycine, serine and threonine metabolism
del00400  Phenylalanine, tyrosine and tryptophan biosynthesis
del01100  Metabolic pathways
del01110  Biosynthesis of secondary metabolites
del01130  Biosynthesis of antibiotics
del01230  Biosynthesis of amino acids
Module
del_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:del00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DelCs14_1372
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DelCs14_1372
Enzymes [BR:del01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     DelCs14_1372
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEF88404
JGI: DelCs14_1372
UniProt: F6B1K3
Position
complement(1555017..1556273)
Genome map
AA seq 418 aa AA seqDB search
MFEYQYPDASGHFGRFGGSFASETLTHALTELRDAYAKYQNDPEFVAEFQSELAHFVGRP
SPVYHAARMSREMGGAQIYLKREDLNHTGAHKINNVIGQAMLARRMGKPRIIAETGAGQH
GVATATICARYGLECIVYMGAEDVKRQSPNVYRMRLLGATVVPVESGSRTLKDALNEAMR
DWVANVDNTFYIIGTVAGPHPYPAMVRDFQKVIGEECLTQMPEFLGADRQPDAVVACVGG
GSNAMGIFHPYIPFENTRLIGVEAAGEGLDSGKHSASLQRGSSGVLHGNRTFILQDENGQ
ITETHSISAGLDYPGVGPEHAWLQELGRAQYVGITDQEALDAFHYLCRTEGIIPALESSH
AVAYAMQLAKTMRADQSILVNLSGRGDKDIGTVADLSGADYYDRPSMRGLTVKGGAAQ
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgttcgaataccagtaccctgacgcatccggccacttcggccgcttcggcggcagcttt
gccagcgaaaccctgacacacgctctgaccgagctgcgcgacgcctacgccaagtaccag
aacgacccggaattcgttgccgaattccagtccgagctggcccacttcgtcggccgtccc
tcgcccgtctaccacgcggcacgcatgtcgcgcgagatgggcggcgcgcagatctacctc
aagcgcgaagacctcaaccacacgggcgcgcacaagatcaacaacgtgatcggccaggcc
atgctcgcccggcgcatgggcaagccccgcatcattgccgagacgggcgccggccagcac
ggcgtggccacggccaccatctgcgcgcgctacggcctcgaatgcatcgtctacatgggt
gccgaggacgtgaagcgccaaagccccaacgtctaccgcatgcgcctgctgggcgccacc
gtggtgccggtggagtcgggcagccgcacgctcaaggacgcgctcaacgaggccatgcgc
gactgggtggccaacgtggacaacaccttctacatcatcggcaccgtggccggcccccat
ccctacccggcgatggtgcgcgacttccagaaggtcatcggcgaggaatgcctgacgcag
atgcccgaattcctgggcgccgaccgccagcctgatgccgtggtcgcctgcgtgggcggc
ggcagcaatgccatgggcatcttccacccctacatcccgttcgagaacacgcgcctgatc
ggcgtggaggcggccggcgaaggcctggacagcggcaagcactcggcctcgctgcagcgc
ggcagcagcggcgtgctgcacggcaaccgcaccttcatcctgcaggacgagaacggccag
atcaccgagacgcacagcatcagcgccggcctcgactaccccggcgtcggccccgagcac
gcctggctgcaggaactgggccgggcccagtacgtgggcatcaccgaccaggaggcgctg
gacgccttccactacctgtgccgtaccgaaggcatcattcccgccctggagtccagccat
gccgtggcctatgccatgcaactggccaagaccatgcgcgccgaccagtccatcctcgtg
aacctgtccggtcgcggcgacaaggacatcggcactgtggccgacctctcgggcgccgat
tactacgaccgtccctccatgcgcgggctcacggtcaagggaggagcagctcaatga

DBGET integrated database retrieval system