KEGG   Delftia sp. Cs1-4: DelCs14_1397Help
Entry
DelCs14_1397      CDS       T01497                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
del  Delftia sp. Cs1-4
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:del00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DelCs14_1397
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DelCs14_1397
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    DelCs14_1397
Enzymes [BR:del01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     DelCs14_1397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1582380..1583807
Genome map
AA seq 475 aa AA seqDB search
MLYLSTRGHADRKRFCDILLEGLAPDGGLYLPEHYPQIDAARLGELRSIYKEQGYAALAF
EILSLYIDDIPAEDLRALCAKTYTQQVFGTAEITPLRALEDGLWLEALSNGPTLAFKDMA
MQLLGNLFEYELGRRGEELNILGATSGDTGSAAEYAMRGKQGVRVFMTSPRGRMSPFQQA
QMFSLQDANIHNIAIEGVFDDCQDIVKAVSNDHAFKAKYKIGTVNSINWARLLAQVVYYF
AGYLQATQSNDQKVSFTVPSGNFGNICAGHVARQMGLPIARLVVATNENDVLDEFFRTGA
YVVRGSEHTYETSSPSMDISKASNFERFVFDLLGRDGQATRELFAEGVARQGRFDLGGNP
LFQEAAARYGFVSGKSTHADRLATIRDTFERFGTMIDTHTADGVKVAREQLQAGVPMIVL
ETALPIKFAATIEEALGRLPDRPAKFEGIEDLPKRVTDLPADAEQVKAYIARHCD
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgctttatctttccacgcgcggccacgcggaccgcaagcgcttttgcgacatcctgctc
gagggcctggcgcccgatggcgggctgtacctgcccgagcactatccgcagatcgatgcc
gcccgcctgggcgagctgcgcagcatctacaaggagcagggctacgcggccctggccttc
gagatcctgagcctgtacatcgacgacatcccggccgaggatctgcgcgccctgtgcgcc
aagacctatacgcagcaggtgttcggcacggccgagatcacgccgctgcgcgcgctggaa
gacggcctgtggctcgaagccctgtccaacggccccacgctggccttcaaggacatggcc
atgcagctgctgggcaacctgttcgagtacgaactgggccgccgtggcgaggaactgaac
atcctgggtgccaccagtggcgataccggcagcgcggccgagtacgccatgcgcggcaag
cagggtgtgcgcgtgttcatgaccagcccgcgcggccgcatgagccctttccagcaggcc
cagatgttcagcctgcaggatgccaacatccacaacatcgccatcgagggcgtgttcgac
gactgccaggacatcgtcaaggccgtctccaacgaccacgccttcaaggcgaagtacaag
atcggcacggtcaactcgatcaactgggcccgcctgctggcccaggtcgtctactacttc
gccggttacctgcaggccacgcagagcaatgaccagaaggtcagcttcacggtgcccagc
ggcaacttcggcaacatctgcgccggccatgtggcgcgccagatgggcctgccgatcgca
cgcctggtggtggcgaccaacgagaacgatgtgctcgacgagttcttccgcacgggcgcc
tacgtggtgcgcggcagcgaacatacctacgagacatcaagcccctcgatggacatctcc
aaggccagcaacttcgagcgcttcgtgttcgacctgctgggccgtgatggccaggccacg
cgcgaattgttcgccgagggcgtggcacgccagggccgcttcgacctgggcggcaacccg
ctgttccaggaagctgctgcccgctacggctttgtcagcggcaagagcacgcatgccgac
cgcctggccaccatccgcgataccttcgagcgcttcggcaccatgatcgacacgcacacg
gccgacggcgtcaaggtggcgcgcgagcagctgcaggccggcgtgcccatgatcgtgctg
gagacggcactgcccatcaagttcgccgccaccatcgaggaagccctgggccgcctgccc
gatcgcccggccaagttcgaaggcatcgaggacctgcccaagcgcgtgaccgacttgccg
gccgacgccgagcaggtcaaggcctatatcgcccggcattgcgactga

DBGET integrated database retrieval system