KEGG   Delftia sp. Cs1-4: DelCs14_1433Help
Entry
DelCs14_1433      CDS       T01497                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
del  Delftia sp. Cs1-4
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:del00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DelCs14_1433
   01230 Biosynthesis of amino acids
    DelCs14_1433
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DelCs14_1433
   00051 Fructose and mannose metabolism
    DelCs14_1433
   00562 Inositol phosphate metabolism
    DelCs14_1433
Enzymes [BR:del01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     DelCs14_1433
Exosome [BR:del04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   DelCs14_1433
  Exosomal proteins of bladder cancer cells
   DelCs14_1433
  Exosomal proteins of melanoma cells
   DelCs14_1433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1619739..1620485
Genome map
AA seq 248 aa AA seqDB search
MKKKLIVGNWKMNGSLAANAVLLKALKEGLPEGGNAGVAVAVPAVYLAQAQAELEGSAIG
VAAQDVSQHESGAYTGELSAAMLRDFGVRYTLVGHSERRQYHGETDAVVALKAQAALAKG
VTPIVCVGETLAEREAGQTEEVVKRQLAAVIHQVGQCINELVVAYEPVWAIGTGRTATPE
QAQQVHAVLRAQLAAASQQADRIALLYGGSMNASNAAQLLAQADIDGGLVGGASLKAADF
LTIIAAAQ
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagaaactcatcgtcggcaactggaagatgaatggcagcctggctgccaatgcc
gttttgctcaaggccctcaaggagggtctgcccgaggggggcaatgcgggcgtggctgtg
gccgtgcctgccgtctatctggcccaggcccaggccgagcttgaaggctcggccatcggc
gtggccgcgcaggacgtgtcgcagcatgaatcgggtgcctatacgggcgagctgtcggcc
gcaatgcttcgggattttggcgtgcgctatacgctggtggggcactcggagcgtcgccag
taccatggcgaaaccgatgccgtggtggcgctgaaggcgcaggctgcgctggccaagggc
gtcacgcccatcgtctgtgtgggcgaaacgctggcggagcgcgaggcggggcagaccgaa
gaagtggtcaagcgccaactggcggccgtgatccaccaggtgggccagtgcatcaatgag
ctggtcgtggcctatgagcccgtctgggccattggcaccggcaggaccgccacaccggag
caggcccagcaggtgcatgccgtgctgcgcgcccaactggcggctgccagccagcaggcc
gatcgcatcgccttgctgtacggcggcagcatgaatgcctccaatgcggcccagctgctg
gcccaggccgacattgatggtggcctggtgggcggagcgtcgctcaaggcggccgatttt
ctgaccatcatcgctgcggcccagtaa

DBGET integrated database retrieval system