KEGG   Delftia sp. Cs1-4: DelCs14_1584Help
Entry
DelCs14_1584      CDS       T01497                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
del  Delftia sp. Cs1-4
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1796174..1797772)
Genome map
AA seq 532 aa AA seqDB search
MAERSASELARETLRQLALNRLPPTPENYTRLYEQAAGEPGPASFPQGPLRHVHALLPAQ
TPGQKRLRDQLGAAIERSDWQGLQQVITAYANAALQPPAHEARPVELPVPPPVQALPDDL
TQQLARRFEALSTLLDTQDTKTRQLHQQLMEQLQSPPVDAKALARRLHDQHYQLSFAIAD
QLQVLQLMQELLQTLVQHLAQDPTHGSWLVQQLTAIEQAITPPLSPAPLADARRELQTVI
HRRLQLQDGMAAAQQALRDMLGGFVQHLAQITSSNETLGARMEEAARQLDGIQRLEDAAP
LLQQVLEATRTMAAGSRVAQEELQALRAHVDACEARIETLQQELDEAARRARHDPLTGQL
NRLGVSEALDREVARAQRHGQPLSVALVDMDGMQALNAELGHAMGDAALVHVAQLARQGL
RPEDVVGRYEGQAFVLLLPQTPETAGAQALQRLLQLLEQAPLPASAQTPGQPAPRPLSFS
AGVAQLQSHENGMDVLRRADTAMLQAKERGKHCIATASGAQWQPVGNAGAGL
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggccgagcgctccgcttccgaactggcacgcgaaaccctgcggcaactggcgctgaac
cgcctgccgcccaccccggaaaactacacccgcctttatgaacaggcggccggcgagccc
ggccccgccagctttccccagggcccgctgcgccatgtccatgcgcttttgccagcgcag
acgcccggacagaagcgcctgcgcgaccagttgggcgccgccatagagcgcagcgactgg
caagggctgcagcaggtcatcaccgcctatgccaacgcggccctgcagccgcccgcccat
gaggcccggcccgtggagctgcccgtgccgccgcccgttcaggccctgcccgacgacctg
acccagcagttggcgcggcgcttcgaggccttgtccacgctgctggacacccaggacacc
aaaacccggcaactgcaccagcagctgatggagcagctgcaatcgccgcccgtggatgcc
aaggccctggcgcggcgcctgcacgaccagcactaccagctgtcgttcgccatcgccgac
cagcttcaggtcctgcagttgatgcaggagttgctgcagaccctggtgcagcacctggcc
caggaccccacgcatggcagctggctggtgcagcagctcacggccatcgagcaggccatc
accccgccgctgtcgcccgcgcccctggccgatgcacggcgcgagctgcagaccgtgatc
caccggcgcctgcagctgcaggacggcatggccgccgcgcagcaggcgctcagggacatg
ctgggcggcttcgtccagcacctggcgcagatcacgagcagcaacgaaacgctgggcgcc
cgcatggaagaggcggcacgccagctggacggcatccagcgcctggaagacgcagccccg
ctgctgcagcaggtgctggaggccacgcgcaccatggccgccggcagccgcgtggcccag
gaggagctgcaggcgctgcgcgcccatgtcgatgcctgcgaggcccgcatcgaaacactg
cagcaggagctggacgaggccgcgcgccgcgcacgccacgacccgctgaccggccagctc
aaccgcctgggcgtgagcgaggcactggaccgcgaggtggcacgcgcacagcgccatggc
cagccgctgagcgttgccctggtcgacatggacggcatgcaggccctcaatgccgagctg
gggcatgccatgggcgatgccgcgctggtgcatgtggcccagttggcgcgccaagggctg
cgcccggaagacgtggtgggccgctatgaaggccaggccttcgtgctgctgctgccgcag
accccggagacggcgggcgcccaggcgctgcagcgccttctgcagctgctggagcaggcg
cctttgcccgcatctgcgcagaccccaggccagcccgcaccccggcccctgagcttcagc
gcgggcgtggcccagttgcaaagccacgaaaacggcatggacgtgctgcgccgcgccgac
accgccatgctgcaggccaaggagcgcggcaagcactgcattgccacggcatcaggcgca
caatggcagccagttggaaatgcaggcgccggcctttga

  All links  
No link information was found.   
DBGET integrated database retrieval system