KEGG   Delftia sp. Cs1-4: DelCs14_1587Help
Entry
DelCs14_1587      CDS       T01497                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
del  Delftia sp. Cs1-4
Brite
Enzymes [BR:del01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     DelCs14_1587
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1799729..1800517
Genome map
AA seq 262 aa AA seqDB search
MSERRPGVPSWVARSVQTPAPASRAAPARSALAPAGARVPQQPSGIGLDSAAVRARMVQR
LAATGIQSPAVLAAMGSVERHRFVDSALVNQAYEDTSLPIGLGQTISKPSVVARMTELLL
GSEAAKSGLGRVLEIGTGCGYQAAVLARVAREVYSIERLRGLHEKARSNLRPWRLTNVHL
IFGDGMEGYGSGAPYAGIISAAGGESMPSAWCDQLAVGGRLVAPMVVTGGKQALLVIDKS
SHGFTQSILEAVNFVPLKSGIA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgagcgccgtcccggagttccctcgtgggtggcgcgctcggtgcagacccctgcg
ccggcctcgcgcgcggcgcctgcgcgctctgcgctggcgccggccggtgcccgtgtcccg
caacagccttcgggcatcggcctggactcggccgccgtgcgcgcccgcatggtgcagcgg
ctggctgccaccggcatacagtcgccggccgtgctggccgccatgggatcggtggagcgc
caccgctttgtggacagcgccctggtcaaccaggcctatgaagacaccagcctgcccatt
ggcctgggccagacgatctccaagcccagcgtggtcgcccgcatgaccgagctgctgctg
ggttcggaagccgcgaagtcgggcctgggccgcgtgctggaaatcggcacgggctgcggc
tatcaggcggcggtgctggcgcgcgtggcacgcgaggtctattcgatcgagcgcctgcgc
ggcctgcacgagaaggcacgcagcaacctgcgtccctggcggctgaccaatgtccatctg
atctttggagatggcatggaaggctatggcagcggcgcgccgtatgcgggcatcatctcg
gccgctggcggcgagagcatgccctcggcctggtgcgaccagctggccgtgggcgggcgg
cttgtcgcccccatggtggttacgggtggtaagcaggcactgctggtgattgacaagagt
tcacacgggtttacgcagtcgattttggaggccgtgaactttgtccccctaaaatcgggc
atcgcctag

DBGET integrated database retrieval system