KEGG   Delftia sp. Cs1-4: DelCs14_1693Help
Entry
DelCs14_1693      CDS       T01497                                 

Definition
(RefSeq) disulfide bond isomerase DsbC/G
  KO
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
del  Delftia sp. Cs1-4
Brite
Enzymes [BR:del01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     DelCs14_1693
Secretion system [BR:del02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   DelCs14_1693
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1914708..1915556)
Genome map
AA seq 282 aa AA seqDB search
MTATTEHLRSRRPRSAAALLGAALCTALLAGVSAGHAATADEARLLAALRKAHPGTQFTE
VARTDVEGLYEVWMSGNVAYVSAANPRFFVFGRLFDTQSMRDVTGPRIAQRHADTGGQLQ
SESVPAAPVPIDQLPLADAIKTVRGSGKRVVAVFSDPNCIYCKQLEPELAGIGDVTVYTF
LVPFQGEARPIAIWCAADRERAWRQWMLQADASLLQPNAGCEHPIARNLDLARRLGVQGT
PTLIWADGTRTDGYVGRSVLEARLNEAAKVATAKPSSAGKKP
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgacggcaactactgaacacctgcgctcgcgccgcccccggtccgccgcagcgctcctt
ggcgcggcgctctgcacggcactgctggccggtgtgtccgcggggcatgctgcgacggcc
gacgaagcccgtttgctggccgccctgcgcaaggcccatcccggcacgcagttcaccgag
gtcgcgcgcaccgacgtggagggcctctacgaagtctggatgagcggcaatgtcgcctac
gtctcggcggccaacccgcgattcttcgtcttcggccgcctcttcgacacgcagagcatg
cgcgacgtcacggggcccaggatcgcgcagcgccatgccgacaccggcgggcagctccag
tccgagtccgtgcccgcggcccccgtgccgatcgaccagctgccgctggccgacgcgatc
aagacggtgcgcggcagtggcaagcgcgtcgtcgcggtcttcagcgaccccaactgcatc
tactgcaagcagcttgaacccgagctcgccggcatcggcgacgtcaccgtctacaccttc
ctcgtgccgttccagggcgaggcccgtcccatcgcgatctggtgcgccgccgaccgcgag
cgcgcctggcgccagtggatgctgcaggcggacgcgagcctgctccagcccaacgcgggc
tgcgagcacccgatcgcgcgcaacctggacctggcgcgccgcctcggcgtgcagggcaca
cccacgctgatctgggccgatggcacgcgcacggacggctacgtcgggcgctccgttctg
gaggccaggctcaacgaggccgccaaggtcgcgaccgcgaagccatcctccgcggggaag
aagccatga

DBGET integrated database retrieval system