KEGG   Delftia sp. Cs1-4: DelCs14_1909Help
Entry
DelCs14_1909      CDS       T01497                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
del  Delftia sp. Cs1-4
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:del00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DelCs14_1909
Enzymes [BR:del01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     DelCs14_1909
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2152573..2153751
Genome map
AA seq 392 aa AA seqDB search
MKQKITVLGSTGSIGTNTLDVVARHREHYEVFALSAATQVDLMLRQCAEFKPAYAVMASA
PHAKLLAEQLRSNGLATEVLQSPDALEQIASHPEVDAVMAAIVGAVGLAPCLAAARAGKR
LLLANKEALVVGGALFMDTVKRHGATLLPIDSEHSAIFQCLPEDRASWPDRVDSLLLTAS
GGPFRLRDPATLSEITPEQACAHPNFSMGRKISVDSATMMNKALEVIEARWLFDMAPDKI
KVVIHPQQIVHSMVQFKDASVLAQLGTPDMRVPIACGLAWPQRIASGAAPLDFAKLSALT
FEEADAVRFPGLHLSWQALLASEGTTAVLNASNEVAVAAFLERRLAFDRIHAVNLRTLET
LLPPTLGSLDDLLALDAQAREIAHTVARQWQL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagaaaatcaccgtcctgggctccacgggctccatcggtaccaatacgctggac
gtggtggcgcgccaccgcgagcactacgaggtctttgcactcagcgcggccacgcaagtg
gacctgatgctgcgccagtgcgccgaattcaagcccgcctatgccgtcatggccagcgcg
ccacacgcgaagttgctggctgaacagctgcgcagcaatgggctggcgaccgaagtgctg
cagtcgccagacgcgctggagcagatcgcctcgcatcccgaggtcgatgccgtcatggct
gccatcgtcggtgcggtgggccttgcgccttgtcttgcggccgcgcgcgcgggcaagcgc
ctgctgctggccaacaaggaggctctggtcgttggcggcgcactcttcatggacacggtc
aagcgccacggcgcgaccctgctgcccatagacagcgagcattcggccatttttcagtgc
ctgccggaagaccgagccagctggcccgatcgcgtggacagtctgctgctcacggcgtcg
ggcggaccctttcgcctgcgcgatccggccaccttgtccgagatcacgccggagcaggcc
tgcgcgcacccgaacttctccatggggcgcaagatctccgtggactcggcgaccatgatg
aacaaggcgctggaggtcatcgaggcacgctggctgttcgacatggctcccgacaagatc
aaggtcgtcatccacccgcagcagatcgtgcactccatggtgcagttcaaggatgcttcg
gtgctggcacaactgggcacgcccgacatgcgcgtgcccatcgcctgcggcctggcctgg
ccccagcgcatcgccagcggcgcagcgcccctggatttcgcgaagctgtcggccctgacc
tttgaagaggcggatgccgtgcgctttccgggcctgcatctttcctggcaggcgctgctc
gccagcgagggaactacggcggttctcaatgcttccaatgaagtcgccgttgccgccttc
ctggagcgacgcctggcatttgaccgtatccacgctgtgaatttgcgcactctcgaaacc
ttgctgccgcctacactgggcagcctggacgatctgctggccctggacgcccaggcccgt
gaaatcgcgcacaccgtggcgcggcagtggcagctgtaa

DBGET integrated database retrieval system