KEGG   Delftia sp. Cs1-4: DelCs14_1950Help
Entry
DelCs14_1950      CDS       T01497                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
del  Delftia sp. Cs1-4
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:del00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    DelCs14_1950
DNA repair and recombination proteins [BR:del03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      DelCs14_1950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2202585..2203175
Genome map
AA seq 196 aa AA seqDB search
MSDVQSLDGLIEALRRLPGVGIKSAQRMAFHLLQRDQDGARQLARALTTAVESVTHCERC
HTFTEGRICSICQDEGRDAARLCVVEAPADMAAMERTGAYQGYYYVLMGRLSPLDGIGPR
DLNLSSLLERAGDGKVQEVILATSFTAEGEATAHAISEALKARGIHVTRLARGVPIGSEL
EYVDLGTIAHALVDRR
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacgtgcaatcgctcgatggcctgatcgaggccttgcgcaggctcccgggtgtg
ggcatcaagtcggcgcagcgcatggccttccacctgctgcagcgcgaccaggacggcgcg
cggcaactggcccgtgccctgaccacggccgtggagtcggtcacccactgcgagcgctgc
cataccttcaccgaaggccgcatctgctccatctgccaggatgaagggcgtgacgcggcc
cggttgtgcgtggtggaggcacccgccgatatggcggccatggagcgcacgggtgcctac
caaggctattactacgtgctgatggggcggttgtcgccactcgacggcataggtccgcgc
gatctgaacctgtcatccctgctggagcgtgccggcgacggcaaggtgcaggaggtgatc
ctggccaccagcttcacggccgaaggcgaggccacggcccatgcgatcagcgaggccctg
aaggcgcgcggcatccatgtgacgcggctggcgcgcggcgtgcccataggcagcgaactc
gaatacgtggacctcggtacgatcgcccatgcgctggtggaccgccggtag

DBGET integrated database retrieval system