KEGG   Delftia sp. Cs1-4: DelCs14_2193Help
Entry
DelCs14_2193      CDS       T01497                                 

Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
del  Delftia sp. Cs1-4
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:del00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DelCs14_2193
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    DelCs14_2193
Enzymes [BR:del01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     DelCs14_2193
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2510130..2511461
Genome map
AA seq 443 aa AA seqDB search
MPQSLTQQLSREQQISALEKDWAQNPRWKGVKRGYSAADVVRLRGSLQPEYTLAQRGAEL
LWDRINGGAKKGYVNAFGAISAGQAMQQAKAGLEAVYLSGWQVAADGNTSETMYPDQSLY
AYDSVPTMVRRINNTFKRADEIQWGRGINPGDKEFIDYFLPIVADAEAGFGGVLNAFELM
KNMIAAGAAGVHFEDQLAAVKKCGHMGGKVLVPTQEAVEKLISARFAADVMGVPTIVLAR
TDAEAANLITSDHDANDKPFLTGERTQEGFYRVRNGMEQSISRGVAYAPYADLVWCETGV
PDIGFAREFAQAVHAACPGKLLSYNCSPSFNWKKNLNDSQIASFQEDLSALGYKFQFITL
AGIHINWFNTFKFAHAYANGEGMKHYVNMVQEPEFAAREQGYTFVSHQQEVGAGYFDDVT
TVIQGGSSSVKALTGSTEEEQFH
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgccccaatccctgacccagcaactgagccgtgaacagcagatttccgcccttgagaaa
gactgggcgcagaacccccgttggaagggcgtcaagcgcggctacagcgccgccgacgtg
gtgcgcctgcgcggcagcctgcagcccgagtacacgctggcccagcgtggcgcggaactg
ctctgggacaggatcaacggcggtgccaagaagggctacgtgaatgcctttggcgccatc
tccgcaggccaggccatgcaacaggccaaggctggcctggaagcggtgtacctgtcgggc
tggcaggtggcggccgacggcaacaccagcgaaaccatgtaccccgaccagtcgctgtac
gcctatgactcggtgcccaccatggtgcgccgcatcaacaacaccttcaagcgtgccgac
gaaatccagtggggccgtggcatcaaccccggcgacaaggagttcatcgactacttcctg
cctatcgtcgccgatgcggaagccggttttggcggcgtgctcaacgctttcgaactgatg
aagaacatgattgccgctggcgcagccggcgtgcacttcgaggaccaactggctgccgtg
aagaagtgcggccacatgggtggcaaggttctggtgcccacccaggaagccgtcgagaag
ctgatctccgcccgctttgccgctgacgtgatgggcgtgcctaccatcgtgctggcccgc
accgatgctgaagccgccaacctgatcacctccgatcacgacgccaacgacaagccgttc
ctgaccggcgagcgcacgcaggaaggcttctaccgtgtccgcaatggcatggagcagtcc
atcagccgcggtgtggcctatgcgccctatgccgacctggtgtggtgcgaaaccggcgtg
cccgacatcggctttgcccgcgagttcgcccaggccgtgcatgccgcctgcccaggcaag
ctgctgagctacaactgctcgccttcgttcaactggaagaagaacctcaacgacagccag
atcgcgtctttccaggaagacctgtctgctctgggctacaagttccagttcatcacgctg
gccggcattcacatcaactggttcaacacgttcaagtttgcccacgcctacgccaacggc
gaaggcatgaagcactacgtgaacatggtgcaggagcccgaattcgcagcccgcgaacaa
ggctacaccttcgtgtcccaccagcaggaagtgggtgcaggctacttcgacgacgtgacc
acggtgatccagggcggctcgtccagcgtgaaggcgctgaccggctccacggaagaggag
caattccactga

DBGET integrated database retrieval system