KEGG   Delftia sp. Cs1-4: DelCs14_2820Help
Entry
DelCs14_2820      CDS       T01497                                 

Definition
pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
del  Delftia sp. Cs1-4
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:del00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DelCs14_2820
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DelCs14_2820
   00020 Citrate cycle (TCA cycle)
    DelCs14_2820
   00620 Pyruvate metabolism
    DelCs14_2820
Enzymes [BR:del01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     DelCs14_2820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3181081..3182763
Genome map
AA seq 560 aa AA seqDB search
MALVEIQVPDIGDFDEVAVIEVLVKAGDQIKAEQSLITVESDKASMEIPSSHAGVVKELR
VNMGDKVKQGSIIAVVESAEAAAPAPAAAAPAPAAAAPAPVAAPAPAAAPAAAPAASGAA
TQVDIKIPDIGDFKDVAVIEMLVKVGDTVTAEQSLFTVESDKASMEIPSPAAGTITALTL
KIGDTVNVGDVVGQMSVQGAAAPAAQAAAPAPAAAAPAPATAAPAAAPVAAASAPAAAPA
HNPTVAPTGKLPHASPSVRKFARELGVPLDEVKGSGNKGRITADDIQAFTKSVMAGAVQT
KAQAATAPKGGSGGGAGLDLLPWPKVDFAKFGPVERKDLSRIKKISGANLSRNWVMIPHV
TNNDEADITDLEAFRVSTNKENEKSGVKVTMLAFVIKAVVAALKKFPEFNASLDGDTLVY
KQYFHVGFAADTPNGLVVPVLRDADKKGILQISQEMGELAKKARDGKLGAADMQGGCFSI
SSLGGIGGTNFTPIINAPEVAILGLSKGQMKPVWDGKQFVPRLTLPLSLSYDHRVIDGAS
AARFNAFLGQVLADYRRILL
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atggcattggtagaaattcaagtccccgatatcggtgatttcgacgaagttgctgtgatc
gaagtgctggtcaaggccggcgatcagatcaaggccgagcaatcgctgatcacagtggag
tccgacaaggcctccatggagatcccctccagccacgctggcgtggtcaaggagctgcgc
gtcaacatgggcgacaaggtcaagcagggcagcatcattgccgtggtcgagtcggcggaa
gccgctgccccggcacctgcagccgccgcaccggcccccgccgctgcagccccggccccg
gtggctgcgcctgcaccggccgctgctcccgctgccgcgcctgcggcctcgggcgccgcc
acgcaggtcgacatcaagattcccgacattggcgacttcaaggacgtggccgtgatcgag
atgctggtcaaggttggcgacaccgtgacggccgagcaatcgctgttcaccgtcgagtcc
gacaaggcctcgatggaaatcccgtcgccagcggccggcaccatcacggcgctgacgctc
aagatcggtgacacggtcaacgtgggcgatgtggtcggccagatgagcgtgcagggcgct
gccgcgcctgcagcccaggctgcggccccggcacctgctgctgcagcccctgcaccggca
actgctgccccggccgctgctccggtcgctgcagcatcggctcccgccgctgcacctgcg
cacaaccccaccgtggcgcccacgggcaagctgccccatgcatcgccctcggtacgcaag
ttcgcccgcgaactcggcgttccgctggacgaggtcaagggctcgggcaacaagggccgc
atcacggccgacgacatccaggctttcaccaagtccgtcatggcgggcgccgtgcagacc
aaggcccaggccgcgaccgctcccaagggtggctccggcggcggcgcaggtctggacctg
ctgccctggcccaaggtcgacttcgccaagttcggcccggtcgagcgcaaggacctgtcg
cgcatcaagaagatcagcggcgccaacctgtcgcgcaactgggtcatgatcccgcacgtc
accaacaatgacgaggccgacatcaccgacctggaagccttccgtgtctccaccaacaag
gagaacgagaagagcggcgtcaaggtgaccatgctggccttcgtgatcaaggcggtggtt
gcggccctcaagaagttccccgagttcaatgcctcgctggacggcgataccctggtctac
aagcagtacttccacgtcggctttgcggccgacacgcccaacggcctggtggtccccgtg
ctgcgcgatgccgacaagaagggcatcctgcagatcagccaggaaatgggcgagctggcc
aagaaggcccgcgacggcaagctcggcgccgccgacatgcagggcggctgcttctcgatc
tcgtcgctgggcggcatcggtggcacgaacttcacccccatcatcaacgcccctgaagtg
gccatcctcggcctgtccaagggccagatgaagccggtgtgggatggcaagcaattcgtg
ccgcgcctgacgctgccgctgtcgctgtcctatgaccaccgtgtcatcgacggtgcctcg
gccgcgcgcttcaatgccttcctgggccaagtgctggcggactaccgccgcatcctgctg
taa

DBGET integrated database retrieval system