KEGG   Delftia sp. Cs1-4: DelCs14_2820Help
Entry
DelCs14_2820      CDS       T01497                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
del  Delftia sp. Cs1-4
Pathway
del00010  Glycolysis / Gluconeogenesis
del00020  Citrate cycle (TCA cycle)
del00620  Pyruvate metabolism
del01100  Metabolic pathways
del01110  Biosynthesis of secondary metabolites
del01120  Microbial metabolism in diverse environments
del01130  Biosynthesis of antibiotics
del01200  Carbon metabolism
Module
del_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:del00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DelCs14_2820
   00020 Citrate cycle (TCA cycle)
    DelCs14_2820
   00620 Pyruvate metabolism
    DelCs14_2820
Enzymes [BR:del01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     DelCs14_2820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H NQRA RnfC_N HlyD_D23 DUF2254 FAP
Motif
Other DBs
NCBI-ProteinID: AEF89832
JGI: DelCs14_2820
UniProt: F6ANJ1
Position
3181081..3182763
Genome map
AA seq 560 aa AA seqDB search
MALVEIQVPDIGDFDEVAVIEVLVKAGDQIKAEQSLITVESDKASMEIPSSHAGVVKELR
VNMGDKVKQGSIIAVVESAEAAAPAPAAAAPAPAAAAPAPVAAPAPAAAPAAAPAASGAA
TQVDIKIPDIGDFKDVAVIEMLVKVGDTVTAEQSLFTVESDKASMEIPSPAAGTITALTL
KIGDTVNVGDVVGQMSVQGAAAPAAQAAAPAPAAAAPAPATAAPAAAPVAAASAPAAAPA
HNPTVAPTGKLPHASPSVRKFARELGVPLDEVKGSGNKGRITADDIQAFTKSVMAGAVQT
KAQAATAPKGGSGGGAGLDLLPWPKVDFAKFGPVERKDLSRIKKISGANLSRNWVMIPHV
TNNDEADITDLEAFRVSTNKENEKSGVKVTMLAFVIKAVVAALKKFPEFNASLDGDTLVY
KQYFHVGFAADTPNGLVVPVLRDADKKGILQISQEMGELAKKARDGKLGAADMQGGCFSI
SSLGGIGGTNFTPIINAPEVAILGLSKGQMKPVWDGKQFVPRLTLPLSLSYDHRVIDGAS
AARFNAFLGQVLADYRRILL
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atggcattggtagaaattcaagtccccgatatcggtgatttcgacgaagttgctgtgatc
gaagtgctggtcaaggccggcgatcagatcaaggccgagcaatcgctgatcacagtggag
tccgacaaggcctccatggagatcccctccagccacgctggcgtggtcaaggagctgcgc
gtcaacatgggcgacaaggtcaagcagggcagcatcattgccgtggtcgagtcggcggaa
gccgctgccccggcacctgcagccgccgcaccggcccccgccgctgcagccccggccccg
gtggctgcgcctgcaccggccgctgctcccgctgccgcgcctgcggcctcgggcgccgcc
acgcaggtcgacatcaagattcccgacattggcgacttcaaggacgtggccgtgatcgag
atgctggtcaaggttggcgacaccgtgacggccgagcaatcgctgttcaccgtcgagtcc
gacaaggcctcgatggaaatcccgtcgccagcggccggcaccatcacggcgctgacgctc
aagatcggtgacacggtcaacgtgggcgatgtggtcggccagatgagcgtgcagggcgct
gccgcgcctgcagcccaggctgcggccccggcacctgctgctgcagcccctgcaccggca
actgctgccccggccgctgctccggtcgctgcagcatcggctcccgccgctgcacctgcg
cacaaccccaccgtggcgcccacgggcaagctgccccatgcatcgccctcggtacgcaag
ttcgcccgcgaactcggcgttccgctggacgaggtcaagggctcgggcaacaagggccgc
atcacggccgacgacatccaggctttcaccaagtccgtcatggcgggcgccgtgcagacc
aaggcccaggccgcgaccgctcccaagggtggctccggcggcggcgcaggtctggacctg
ctgccctggcccaaggtcgacttcgccaagttcggcccggtcgagcgcaaggacctgtcg
cgcatcaagaagatcagcggcgccaacctgtcgcgcaactgggtcatgatcccgcacgtc
accaacaatgacgaggccgacatcaccgacctggaagccttccgtgtctccaccaacaag
gagaacgagaagagcggcgtcaaggtgaccatgctggccttcgtgatcaaggcggtggtt
gcggccctcaagaagttccccgagttcaatgcctcgctggacggcgataccctggtctac
aagcagtacttccacgtcggctttgcggccgacacgcccaacggcctggtggtccccgtg
ctgcgcgatgccgacaagaagggcatcctgcagatcagccaggaaatgggcgagctggcc
aagaaggcccgcgacggcaagctcggcgccgccgacatgcagggcggctgcttctcgatc
tcgtcgctgggcggcatcggtggcacgaacttcacccccatcatcaacgcccctgaagtg
gccatcctcggcctgtccaagggccagatgaagccggtgtgggatggcaagcaattcgtg
ccgcgcctgacgctgccgctgtcgctgtcctatgaccaccgtgtcatcgacggtgcctcg
gccgcgcgcttcaatgccttcctgggccaagtgctggcggactaccgccgcatcctgctg
taa

DBGET integrated database retrieval system