KEGG   Delftia sp. Cs1-4: DelCs14_3227Help
Entry
DelCs14_3227      CDS       T01497                                 

Definition
Superoxide dismutase (EC:1.15.1.1)
Orthology
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
del  Delftia sp. Cs1-4
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3658858..3659439)
Genome map
AA seq 193 aa AA seqDB search
MEHTLPPLPYAIDALAPHYSQETLEYHHGKHHNAYVVNLNNLQKGTEFENMTLEEIVKKS
SGGIYNNAAQIWNHTFFWNCMAPSGGGEPTGALADAINKKWGSYAAFKEAFVKSAVGNFG
SGWTWLVKKADGSVDIVNTGAAGTPLTTEDKALLTVDVWEHAYYIDYRNLRPKFVETFLG
QLVNWKFAEQNFA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggaacataccttgccccctctgccctatgcgattgacgcgctggcaccccactacagc
caggaaacgctggagtaccaccatggcaagcaccacaacgcctatgtggtgaacctgaac
aacctgcaaaagggcaccgaattcgaaaacatgaccctggaagagatcgtcaagaagtct
tccggcggcatctacaacaacgcagcccagatctggaaccacaccttcttctggaactgc
atggcccccagcggtggcggcgagcccaccggcgcactggctgacgccatcaacaagaag
tggggcagctacgccgccttcaaggaagccttcgtgaagtcggccgtgggcaacttcggc
tctggctggacctggctggtcaagaaggccgacggttcggtggacatcgtcaacaccggc
gctgccggcacgcccctgaccacggaagacaaggccctgctgaccgtggacgtctgggaa
cacgcctactacatcgactaccgcaacctgcgtcccaagttcgtcgagaccttcctcggc
caactggtgaactggaagtttgccgagcagaacttcgcctga

DBGET integrated database retrieval system