KEGG   Delftia sp. Cs1-4: DelCs14_3327Help
Entry
DelCs14_3327      CDS       T01497                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
del  Delftia sp. Cs1-4
Pathway
del00020  Citrate cycle (TCA cycle)
del00310  Lysine degradation
del01100  Metabolic pathways
del01110  Biosynthesis of secondary metabolites
del01120  Microbial metabolism in diverse environments
del01130  Biosynthesis of antibiotics
del01200  Carbon metabolism
Module
del_M00009  Citrate cycle (TCA cycle, Krebs cycle)
del_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:del00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DelCs14_3327
  Amino acid metabolism
   00310 Lysine degradation
    DelCs14_3327
Enzymes [BR:del01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     DelCs14_3327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AEF90322
JGI: DelCs14_3327
UniProt: F6AV54
Position
complement(3757442..3758707)
Genome map
AA seq 421 aa AA seqDB search
MAIVEVKVPQLSESIAEATMLTWKKKAGEAVAIDEILIEIETDKVVLEVPAPAAGVLAEI
VQGDGATVVAEQLIAKIDTEGVAGVAAAAPAAAAAPAAAAPAAAPAAAAATGGSKGDVAM
PAAAKLLAENNLSAANVAGSGKDGRVTKGDALAAVKGGVQSTAAVIPTGVPTKALPQVSA
PAAKEDLSGRPEQRVPMSRLRARVAERLLQSQSTNAILTTFNEVNMAPVMDLRKKFQDAF
TKEHGTKLGFMSFFVKAAVHALKKYPVLNASVDGNDIVYHGYFDIGIAVGSPRGLVVPIL
RNADQMSFADIEKKIAEFGKKAADGKLGIEDMTGGTFSISNGGTFGSMMSTPIINPPQSA
ILGVHATKDRAMVENGQVVVRPMNYLAMSYDHRIIDGREAVLGLVAMKDALEDPSRLLFD
L
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgttgaagtcaaagttccccagctgtccgagtccatcgctgaggccaccatg
ctgacctggaagaagaaggccggcgaagcggttgcaatcgatgagatcctcatcgaaatc
gaaaccgacaaggtcgtgctcgaagtgcccgcacccgccgctggcgtgctggccgagatc
gtgcaaggtgacggcgccaccgtggtggccgagcaactgattgccaagatcgacaccgaa
ggcgtggccggcgtggccgccgccgctcctgccgcagccgccgctcccgctgccgcagcg
cctgctgctgctcccgccgctgctgctgccactggcggcagcaagggcgatgtcgccatg
cccgccgctgccaagctgctggccgagaacaacctgtcggccgccaacgtggctggctcc
ggcaaggatggccgcgtgaccaagggcgacgccctggccgccgtcaagggcggcgtgcag
tccacggctgccgtcatccccaccggcgtgcccaccaaggcgctgccccaggtgtcggct
cccgctgccaaggaagacctcagcggccgtcccgagcagcgcgtgcccatgagccgcctg
cgtgcccgtgtggccgagcgcctgctgcagtcgcagtccaccaacgccatcctgaccacg
ttcaacgaagtgaacatggccccggtgatggatctgcgcaagaagttccaggatgccttc
accaaggaacacggcaccaagctgggcttcatgtccttcttcgtcaaggcggcagtgcac
gccctgaagaagtaccccgtgctcaatgcttccgtggacggcaacgacatcgtctaccac
ggctacttcgacatcggtatcgccgtgggttcgccccgtggcctggtggtgcccatcctg
cgcaatgcagaccagatgagcttcgccgacatcgaaaagaagattgccgaattcggcaag
aaggcggcagacggcaagctgggcattgaagacatgaccggcggcaccttctccatctcc
aacggcggcactttcggctcgatgatgtccacccccatcatcaacccgccccagtcggcc
atcctgggcgtgcacgccaccaaggaccgcgccatggtcgagaacggccaggtcgtggtc
cgcccgatgaactatctggccatgtcctatgaccaccgcatcatcgacggccgcgaagcc
gtgctgggcctggtggccatgaaggacgcgctggaagatccttcgcgcctgctgttcgac
ctgtaa

DBGET integrated database retrieval system