KEGG   Delftia sp. Cs1-4: DelCs14_3541Help
Entry
DelCs14_3541      CDS       T01497                                 

Definition
acireductone dioxygenase (EC:1.13.11.54)
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
del  Delftia sp. Cs1-4
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:del00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    DelCs14_3541
Enzymes [BR:del01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     DelCs14_3541
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     DelCs14_3541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4014542..4015072)
Genome map
AA seq 176 aa AA seqDB search
MGSLASHQVSDADFVAAIGVQWQRRPLAPEPGLAALLAQAQLDDGGKATVVQAVGMLVVD
ECVAHGYHSMDLVVLHPGTPGLDEALERFDKPHTHADDEVRYILEGEGLFGFFDAGGQER
VLRVQPGDYLRIPAGVEHRFTLTATRRIKALRLFADTAGWVAQYTQRPAAAMEVPA
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcctcgcatcgcaccaagtttccgacgcggacttcgtggccgccatcggcgtg
caatggcagcgccgcccgctggcgcccgagcccggcctggccgcgctgctggcgcaggcc
caactggacgacggcggcaaggccaccgtggtccaggccgtgggcatgctggtggtcgac
gaatgcgtggcccatggctaccacagcatggatctggtcgtgctgcacccgggcacgccg
ggcctggacgaggcgctggagcgcttcgacaagccccacacccatgccgatgacgaggta
cgctacatcctcgaaggcgaaggcctgttcggcttcttcgatgccggcggccaagagcgc
gtgctgcgcgtgcagcccggcgactacctgcgcataccggccggcgtggagcaccgcttc
acgctgaccgccacgcggcgcatcaaggcgctgcgcctgttcgccgatacggcgggctgg
gtggcgcaatatacccagcggcctgccgctgccatggaggtgcctgcatga

DBGET integrated database retrieval system