KEGG   Delftia sp. Cs1-4: DelCs14_3840Help
Entry
DelCs14_3840      CDS       T01497                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
del  Delftia sp. Cs1-4
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4350257..4351456
Genome map
AA seq 399 aa AA seqDB search
MHKPHSLRRVAAWTAALCGLAGAIALAGCGGGDTAVHDDSGSSTGWSWALPSFFPTPKVP
DTNPMTAEKVELGRFLFYDRRLSGNGTQACASCHIQSKAFTDGLTTSLGSTGHAHPRNAQ
SLANVVYNATLTWANPSLVTLEKQMETPLFGTDPVEMGVNDNNKEEILARLAADTGYGPR
FARAYPGQAAPITWGNVIHAISAFQRTILSGNSKYDQYLKGSTALNPAEQRGMNLFFGEK
AECFHCHSSFNFNDQIVHAGSRIVETPFHNTGLYNIGGTGAFPEPNRGVYELTQLFKDMG
KFRAPSLRNVEVTGPYMHDGSIATLEEVLQFYAAGGRNITSGPHAGDGRANPNKNDFINQ
IALTADDRADLLAFLKTLTDHELLTNPRLADPFARQAGQ
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgcacaagccccattcgcttcggcgggtggcggcatggaccgccgccctgtgcggcctt
gccggggccatcgccctggcgggctgcgggggcggcgacaccgccgtccacgatgactcc
ggcagcagcacgggctggtcctgggcgctgccctcctttttccccacccccaaggtgccc
gacaccaatcccatgacggcagagaaggtcgagctcggccgctttctgttctacgacagg
cgcctttcgggcaatggcacgcaggcctgcgcgagctgccacatacagtccaaggccttc
accgatggcctgacgacctcactgggctccacaggtcacgcacatccgcgcaacgcccag
agcctggccaacgtggtctacaacgccacgctgacctgggccaacccctcgctggtcacg
cttgaaaagcagatggagacgccgctgttcggcacggacccggtggagatgggcgtcaac
gacaacaacaaggaggaaatcctcgcgcggctggctgccgacaccggctacggcccgcgc
ttcgccagggcctacccgggccaggcagcgcccatcacctggggcaatgtgatccacgcc
atctcggcattccagcgcaccattctttcgggcaacagcaaatatgaccagtacctcaag
ggcagcacggcactgaacccggccgagcagcgcggcatgaacctgttcttcggcgaaaag
gccgagtgcttccactgccacagcagcttcaacttcaacgaccagatcgtgcacgcgggc
agccgcatcgtcgagaccccgttccacaacacgggcctctacaacatcggcggcaccggc
gccttccccgagcccaaccggggcgtctacgaactgacccagctcttcaaggacatgggc
aagttccgcgcgcccagcctgcgcaatgtggaggtcaccggcccctacatgcatgacggc
agcatcgcgacgctggaggaagtgctgcagttctatgcggccgggggccgcaacatcacg
tccggcccgcatgccggcgacgggcgcgccaaccccaacaagaacgacttcatcaaccag
atcgccctgacggccgacgaccgcgccgacctgctggcctttctcaaaaccctcacggac
catgagctgctcaccaaccccaggctggccgatccctttgcacggcaggcaggccaatag

DBGET integrated database retrieval system