KEGG   Delftia sp. Cs1-4: DelCs14_3893Help
Entry
DelCs14_3893      CDS       T01497                                 

Definition
3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
del  Delftia sp. Cs1-4
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:del00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:del00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4408860..4409654
Genome map
AA seq 264 aa AA seqDB search
MLKGKTALVTGSTSGIGLGIAKALARQGANIVLNGFGDVDGPRAEVLAAGQAAGAQVAYH
GADMSRVADIEDMVQYSVRNFGQIDILVNNAGIQHVARVEDFPPERWDSIIAINLSSAFH
TSRLVLPMMQAADGGKGWGRIINVASVHGLVGSAQKSAYVAAKHGIVGLTKVTALENATS
GITCNAICPGWVLTPLVQKQVDAKAEQHGISNEEAKKLLLGEKEPSMQFTTPEELGELAV
FFCSPAAANVRGVAWNMDGGWAAQ
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaaggcaagaccgccctcgtgaccggttcgaccagcggaatcggcctcgggatc
gcgaaggcgctggcccgccagggcgccaatatcgtgctcaatggtttcggcgatgtggac
ggcccccgtgccgaagtgctggccgcaggccaggccgccggcgcccaggtcgcctaccac
ggtgccgacatgagccgcgtggcagacatcgaggacatggtccagtacagcgtgcgcaat
ttcggccagatcgacatcctcgtgaacaatgccggcatccagcacgtggcgcgcgtggaa
gacttcccgcccgagcgctgggattccatcatcgccatcaacctgtccagcgccttccac
acctcgcgcctggtcctgcccatgatgcaggcggccgatggcggcaagggctggggccgc
atcatcaacgtggcttcggtgcacggcctggtgggctcggcgcagaagtccgcctatgtg
gcggccaagcacggcattgtcgggctgaccaaggtcacggccctggagaacgccacctcc
ggcatcacctgcaatgccatctgccccggctgggtgctgacgccgctggtgcaaaagcag
gtggacgccaaggccgagcagcacggcatcagcaatgaagaagccaagaagctgctgctg
ggcgaaaaggaaccctcgatgcagttcaccacgcccgaggagcttggcgagctggccgtg
ttcttctgctcgcccgctgccgccaacgtgcgcggcgtggcctggaacatggatggcggc
tgggctgcgcagtaa

DBGET integrated database retrieval system