KEGG   Delftia sp. Cs1-4: DelCs14_3993Help
Entry
DelCs14_3993      CDS       T01497                                 

Definition
malonyl-CoA decarboxylase (EC:4.1.1.9)
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
del  Delftia sp. Cs1-4
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:del00640]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:del00410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4504245..4505690)
Genome map
AA seq 481 aa AA seqDB search
MGLATDWIARNVSRFRSTDAAAPATKSEGEAAKGPAPRGTAQRLQATLRRGQEVLSPREL
RKLMEDLQAAADAGLSDVEGGRHAQLLMDWYAQAELPAHKDFWALIVEQFGPDTEALMAA
RKRYDTAASDAERGQAEMDLRRALMSPRTRLLQRFAQPQGGMGFLVDLRAELLALPKAEQ
QRFSALDAELEHLFANWFDVALLELRRLSWDSPASLIEKLIQYEAVHDIRSWADLKNRLD
SDRRCYGFFHPRMPTVPLIFVEVALVDRMSDSIAPLLDETAAASDLGRATTAIFYSISNT
QAGLRGVSFGDSLIKHVVETLTGEFPRLRHFATLSPIPGLRAWIAKHGDAILEKMDERQR
KAFELKAGGMGAEHLLAALDAPQDLKPDAPVRRALLFCAAHYLGRETAKGRPLDPVARFH
LGNGARVERLNWAADLSAKGLKQSLGLMVNYLYDLKRLDKHRGLLAQGRIPVSSDIEALC
K
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgggtctggctactgactggattgcccgcaatgtgtcccgctttcgcagcaccgatgcg
gctgcgcctgcaacaaagtccgagggcgaggcagccaagggacccgcgccgcgcggcacg
gcccagcgcctgcaggccaccctgcggcgtggccaggaagtgctgtccccgcgcgagctg
cgcaagctcatggaagacctgcaggctgccgccgacgccggcctgagcgatgtcgagggc
ggccgccatgcgcaactgctcatggactggtacgcccaggccgagctgcctgcgcacaag
gatttctgggcgctgatcgtcgagcagttcggccccgataccgaagccctgatggccgcg
cgcaagcgctatgacacggcggccagcgatgccgagcgcggccaggccgagatggacctg
cgccgcgcgctgatgtcgccgcgcacgcggctgctgcagcgctttgcccagccccagggc
ggcatgggctttctggtggacctgcgcgccgaactgctggccctgcccaaggcggagcag
cagcgcttttccgcgctggacgccgagctggagcatctgtttgccaactggttcgacgtg
gccctgctggagctgcgccgcctgagctgggactcgccggcctcgctgatcgaaaagctc
atccagtacgaggccgtgcacgacatccgcagctgggccgacctcaagaaccgcctggac
agcgaccggcgctgctacgggttcttccacccgcgcatgcccaccgtgccgctgatcttc
gtggaggtggcgctggtggaccggatgtccgacagcatcgccccgctgctggacgagacg
gcggcggcctccgacctgggccgcgccaccacggccatcttctactccatcagcaacacc
caggccggcctgcgcggcgtgagctttggcgactcgctgatcaagcatgtggtggagacg
ctgacgggcgagttcccccggctgcgccatttcgccacgctgtctcccattccgggcctg
cgtgcctggatcgccaagcacggcgatgccatcctggagaagatggacgagcgccagcgc
aaggccttcgagctcaaggccggcggcatgggcgccgagcacctgctggcggcgctggat
gcgccgcaggatctcaagcccgacgcacccgtgcgccgcgcactgctgttctgcgctgct
cactatctggggcgcgagacggccaagggccggccgctggacccggtggcacgctttcac
ctgggcaacggcgcgcgcgtggagcggctcaactgggcggccgacctgtcggccaaggga
ctcaagcagtcgctggggctgatggtcaactacctctacgacctcaagcgcctggacaag
catcgcggcctgctggcgcagggccgcataccggtgtcctcggacatcgaagccctgtgc
aaatga

DBGET integrated database retrieval system