KEGG   Delftia sp. Cs1-4: DelCs14_4005Help
Entry
DelCs14_4005      CDS       T01497                                 

Definition
acetyl-coenzyme A synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
del  Delftia sp. Cs1-4
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:del00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DelCs14_4005
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DelCs14_4005
   00620 Pyruvate metabolism
    DelCs14_4005
   00640 Propanoate metabolism
    DelCs14_4005
  Energy metabolism
   00680 Methane metabolism
    DelCs14_4005
Enzymes [BR:del01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     DelCs14_4005
Lipid biosynthesis proteins [BR:del01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   DelCs14_4005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4518251..4520251)
Genome map
AA seq 666 aa AA seqDB search
MSTATASPIESVLVENRVFPPPADFAAKARISGMEQYKALCAEAENDYQGFWARLARENV
VWSKPFTQVLDDSNPPFFRWFADGELNASANCLDKHMGTDVEHKTAIIFEADGGEVTKVS
YRELLERVSQFANALKAQGVQKGDRVLIYMPMTIEGVIAMQACARIGATHSVVFGGFSAK
AVQERIVDVGAVAVITANYQMRGGKELPLKAIVDDALALGGCEAVRHVFVYERTATACAM
TAGRDKTFGEILAGQSTECAPVAVDSEHPLFILYTSGSTGKPKGVQHCTGGYVLWAKQTM
EWTFDLKPSDVFWCTADIGWITGHTYVAYGPLAAGATQIVFEGVPTFPNAGRFWQMIERH
GCTIFYTAPTAIRSLIKAADGDAAVHPKNSDLSSLRLLGSVGEPINPEAWMWYHRNVGGE
RCPIVDTFWQTENGGHVIAPMPGATPLVPGSCTLPLPGIMAAIVDETGHELPNGAGGLLV
VTKPWPSMIRTIWGDPERFKKSYFPAELGGQTYLAGDGAVRSEDRGYFRITGRIDDVLNV
SGHRMGTMEIESALVSKTDLVAEAAVVGRPDDLTGEAICAFVVLKRSRPTGEEAKQIAKE
LRDWVAKEIGPIAKPKDIRFGDNLPKTRSGKIMRRLLRSIAKGEAITQDTSTLENPAILD
QLAETN
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgcaacagcatcccccattgaatcggtactggtggagaaccgggtcttcccg
ccgccggcagacttcgccgccaaggcccgcatctccggcatggagcagtacaaggcgctg
tgcgccgaggcagagaacgactaccagggcttctgggcccgcctggcgcgcgagaacgtg
gtctggtccaagcccttcacccaggtgctggacgacagcaatcccccgttcttccgctgg
ttcgccgacggtgaactcaacgccagcgccaactgcctggacaagcacatgggcacggac
gtcgagcacaagacggccatcatcttcgaggccgatggcggcgaggtcaccaaggtcagc
taccgcgaactgctggagcgcgtctcgcagttcgccaacgcgctcaaggcgcagggcgtg
caaaagggcgaccgtgtcctgatctacatgcccatgaccatcgagggcgtgatcgccatg
caggcctgcgcgcgcatcggcgccacgcacagcgtggtgttcggcggcttctcggccaag
gcggtgcaggagcgcatcgtggacgtgggcgccgtggccgtgatcaccgccaactaccag
atgcgcggcggcaaggagctgccgctcaaggccatcgtggacgatgcgctggcgctgggc
ggctgcgaggccgtgcgccatgtcttcgtctacgagcgcacggccacggcctgtgccatg
acggcaggccgcgacaagaccttcggcgagatcctggccggccagagcaccgagtgcgcg
cccgtggccgtggattccgagcacccgctgttcatcctctacaccagcggctccacgggc
aagcccaagggcgtgcagcactgcacgggcggctatgtgctgtgggccaagcagaccatg
gagtggaccttcgacctcaagcccagcgacgtattctggtgcacggccgacatcggctgg
atcaccggccacacctacgtggcctacggcccgctggccgctggcgccacgcagatcgtg
ttcgagggcgtgcccaccttccccaacgcgggccgcttctggcagatgatcgagcgccac
ggctgcaccatcttctacacggcgcccacggccatccgctcgctgatcaaggccgccgac
ggcgatgccgccgtgcatccgaagaactcggacctgtccagcctgcgcctgctgggcagc
gtgggagagcccatcaatcccgaggcctggatgtggtaccaccgcaatgtgggcggcgag
cgctgccccatcgtggacaccttctggcagaccgagaacggcggccacgtgatcgctccc
atgccgggcgccacgccgctggtgccgggttcgtgcacgctgccgctgccgggcatcatg
gctgccatcgtcgacgagaccggccatgaactgcccaacggcgcaggcggcctgctggtg
gtcaccaagccctggcccagcatgatccgcaccatctggggcgaccccgagcgcttcaag
aagagctacttcccggccgagctgggcgggcagacctacctggccggcgacggcgccgtg
cgcagcgaggaccgtggctacttccgcatcacgggccgcatcgacgatgtgctcaatgtc
tcgggccaccgcatgggaacgatggagatcgagtcggccctggtgtccaagaccgacctg
gtggccgaagccgccgtggtgggccgccccgatgacctgacgggcgaggccatctgcgca
ttcgtggtgctcaagcgctcgcgtcccacgggcgaggaggccaagcagatcgccaaggag
ctgcgcgactgggtggccaaggaaatcggccccatcgccaagcccaaggacatccgcttt
ggcgacaacctgcccaagacgcgcagcggcaagatcatgcgccgcctgctgcgctcgatt
gccaagggcgaggccatcacccaggacacgagcacgctggagaacccggccatcctcgac
cagttggccgagacgaactga

DBGET integrated database retrieval system