KEGG   Delftia sp. Cs1-4: DelCs14_4233Help
Entry
DelCs14_4233      CDS       T01497                                 

Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
del  Delftia sp. Cs1-4
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:del00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DelCs14_4233
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DelCs14_4233
   00650 Butanoate metabolism
    DelCs14_4233
  Energy metabolism
   00190 Oxidative phosphorylation
    DelCs14_4233
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4782008..4782373
Genome map
AA seq 121 aa AA seqDB search
MSVNYGSKRTVVGAHYGIRDWMVQRVTGVLMALFTIVLLAKLIFSTGSVGYDLWAGIFAP
QWMKFLTFAVIVSLAWHVWVGVRDIWMDYVKPVGLRLVLNVFTLVWLVGCAGWGIQILWR
I
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtgaattacggctccaagcgcaccgtggtcggtgcgcactacggcatccgcgac
tggatggtgcagcgcgtcaccggcgtgctgatggcactgttcaccatcgtgctgctggcc
aagctgatcttcagcaccggctccgtcggctatgacctgtgggccggcatctttgccccg
cagtggatgaagttcctgaccttcgccgtgatcgtctcgctggcctggcacgtctgggtc
ggcgtgcgcgacatctggatggactacgtcaagcccgtgggcctgcgcctggtgctgaac
gttttcaccctggtctggctggtcggctgcgccggctggggcatccagatcctgtggcgt
atctga

DBGET integrated database retrieval system