KEGG   Delftia sp. Cs1-4: DelCs14_4374Help
Entry
DelCs14_4374      CDS       T01497                                 

Definition
glycoside hydrolase family protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
del  Delftia sp. Cs1-4
Brite
Enzymes [BR:del01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     DelCs14_4374
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4950538..4951068
Genome map
AA seq 176 aa AA seqDB search
MKWPSNIKIAAGASAVAVGVAGLLVQFLPVEEGRRLGAYRDPIGIPTICEGWTRGVQMGD
RATQAECDLLTRQGIQEAWEVFERWVPAHVRNGMPDQTLAAFLSFIYNVGPGQAGSKDGF
VWLKSGRHSTMLLRLQAGDVRAACEQLPAWVTAAGIRLRGLELRRGREMAMCLEAL
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggcccagcaacatcaagattgctgcaggagcctcggcggtggccgtgggggtg
gctggtctgctggttcagttcctgcccgtggaggaaggccgcaggctgggcgcataccgc
gaccccatcggcattcccacaatctgcgaaggctggacccgtggcgtgcagatgggcgac
cgcgccacgcaggccgaatgcgacctgctgacccgacagggcatacaggaggcctgggaa
gtcttcgagcgctgggtgcctgcccatgtgcgcaacggcatgcccgaccagaccctggcc
gccttcctgagcttcatctacaacgtggggccagggcaggccggcagcaaagacggcttt
gtgtggctcaagagcggccggcattccaccatgctgctgcgcctgcaggccggcgatgtg
cgcgccgcgtgcgagcaactgccggcgtgggtcactgccgcaggcattcgcctgcgcggc
ctggagctgcgcagagggcgcgaaatggcgatgtgcctggaggccctatga

DBGET integrated database retrieval system