KEGG   Delftia sp. Cs1-4: DelCs14_4666Help
Entry
DelCs14_4666      CDS       T01497                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
del  Delftia sp. Cs1-4
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:del00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    DelCs14_4666
Enzymes [BR:del01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     DelCs14_4666
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5261739..5262368
Genome map
AA seq 209 aa AA seqDB search
MDYPGNLFVVSAPSGAGKSSLVRALREFDARVSPSVSHTTRAPRGQEKHGREYYFVSDQE
FDTMVSNNAFVEWANVHSRRYGTAKKALEERIQVGTDVLLEIDYQGALQVKEAFPNAVLI
FILPPSWDELRARLENRGEDAPEVIELRLTNAAEEMAQVAKFDFVIINELFESALFDLKT
IIHAQRLKYAAQRSRRAETFESLNISVPN
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggattaccccggaaacctctttgtcgtctcggcccccagcggggccggcaagtccagc
ctggtgcgagccctgcgcgagttcgatgcgcgtgtctcgccctccgtctcccacaccacc
cgcgcgccgcgtggccaggaaaagcacggccgcgagtactacttcgtctccgaccaggaa
ttcgacaccatggtgtcgaacaacgccttcgtcgaatgggcgaatgtgcacagccgccgc
tacggcacggccaagaaggcgctggaagagcgcatccaggtcggcaccgacgtgctgctg
gagatcgactaccagggcgcgctgcaggtcaaggaggcgtttccgaacgccgttctgatc
ttcatcctgccgcccagctgggacgagcttcgcgcacgcctggaaaaccggggcgaggat
gcacccgaggtgatcgagctgcgcctgacgaacgcggccgaggagatggcccaggtggcg
aaattcgacttcgttataatcaacgaattgttcgagagcgcactgtttgatctcaagacg
atcatccacgcccagcgcctcaagtatgcggctcagcgcagccgccgcgcagagaccttc
gagtctctcaatatttctgtacccaactga

DBGET integrated database retrieval system