KEGG   Delftia sp. Cs1-4: DelCs14_4827Help
Entry
DelCs14_4827      CDS       T01497                                 

Definition
phosphoglycerate mutase family protein (EC:5.4.2.4)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
del  Delftia sp. Cs1-4
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:del00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DelCs14_4827
   01230 Biosynthesis of amino acids
    DelCs14_4827
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DelCs14_4827
  Energy metabolism
   00680 Methane metabolism
    DelCs14_4827
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DelCs14_4827
Enzymes [BR:del01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     DelCs14_4827
Exosome [BR:del04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   DelCs14_4827
  Exosomal proteins of melanoma cells
   DelCs14_4827
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5434917..5435660
Genome map
AA seq 247 aa AA seqDB search
MYKLVLIRHGESTWNLENRFTGWTDVDLTATGVEQAKNAGRLLKAEGYDFDLAYTSVLKR
ATRTLWHTLDEMDRTWLPVQHSWRLNERHYGGLQGLNKADMAKQYGDAQVLVWRRSYDTP
PPALEPQDPRSERSDVRYAQLDPSQVPLTECLKDTVARVLPFWNESIAPAILSGKRVVVA
AHGNSIRALIKYLDGISDDAIVGVNVPNGIPLVYELDANLKPIRHYYLGDAEAAAKAAAA
VAAQGKA
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgtacaagctcgtgctgatccgccacggtgaatccacctggaacctcgaaaaccgcttc
accggctggaccgatgtggacctgaccgccaccggcgtcgaacaggccaagaacgccggc
cgcctgctcaaggccgagggctatgacttcgacctggcctacaccagcgtgctcaagcgc
gccacgcgcacgctgtggcacacgctggacgaaatggaccgcacctggctgcccgtgcag
cacagctggcgcctgaacgagcgccactacggtggcctgcagggcctgaacaaggcggac
atggccaagcaatacggcgacgcccaggtgctggtgtggcgccgcagctacgacacgccc
ccgccggccctggagccgcaagacccgcgcagcgagcgcagcgacgtgcgctacgcccag
ctggaccccagccaggtgccgctgaccgaatgcctgaaggacacggtggcccgcgtgctg
ccgttctggaacgagtccatcgcgcccgccatcctgtccggcaagcgcgtcgtggtcgcg
gcccacggcaactccatccgcgcgctgatcaagtacctggacggcatctcggatgacgcc
atcgtcggcgtcaacgtgcccaatggcattccgctggtctatgagctggatgccaatctc
aagcccattcgccactattacctgggcgatgcagaagctgccgccaaggctgcagccgcc
gtggccgcacagggcaaggcctga

DBGET integrated database retrieval system