KEGG   Delftia sp. Cs1-4: DelCs14_4827Help
Entry
DelCs14_4827      CDS       T01497                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
del  Delftia sp. Cs1-4
Pathway
del00010  Glycolysis / Gluconeogenesis
del00260  Glycine, serine and threonine metabolism
del00680  Methane metabolism
del01100  Metabolic pathways
del01110  Biosynthesis of secondary metabolites
del01120  Microbial metabolism in diverse environments
del01130  Biosynthesis of antibiotics
del01200  Carbon metabolism
del01230  Biosynthesis of amino acids
Module
del_M00002  Glycolysis, core module involving three-carbon compounds
del_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:del00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DelCs14_4827
  Energy metabolism
   00680 Methane metabolism
    DelCs14_4827
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DelCs14_4827
Enzymes [BR:del01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     DelCs14_4827
Membrane trafficking [BR:del04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    DelCs14_4827
Exosome [BR:del04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   DelCs14_4827
  Exosomal proteins of melanoma cells
   DelCs14_4827
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEF91799
JGI: DelCs14_4827
UniProt: F6ARR1
Position
5434917..5435660
Genome map
AA seq 247 aa AA seqDB search
MYKLVLIRHGESTWNLENRFTGWTDVDLTATGVEQAKNAGRLLKAEGYDFDLAYTSVLKR
ATRTLWHTLDEMDRTWLPVQHSWRLNERHYGGLQGLNKADMAKQYGDAQVLVWRRSYDTP
PPALEPQDPRSERSDVRYAQLDPSQVPLTECLKDTVARVLPFWNESIAPAILSGKRVVVA
AHGNSIRALIKYLDGISDDAIVGVNVPNGIPLVYELDANLKPIRHYYLGDAEAAAKAAAA
VAAQGKA
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgtacaagctcgtgctgatccgccacggtgaatccacctggaacctcgaaaaccgcttc
accggctggaccgatgtggacctgaccgccaccggcgtcgaacaggccaagaacgccggc
cgcctgctcaaggccgagggctatgacttcgacctggcctacaccagcgtgctcaagcgc
gccacgcgcacgctgtggcacacgctggacgaaatggaccgcacctggctgcccgtgcag
cacagctggcgcctgaacgagcgccactacggtggcctgcagggcctgaacaaggcggac
atggccaagcaatacggcgacgcccaggtgctggtgtggcgccgcagctacgacacgccc
ccgccggccctggagccgcaagacccgcgcagcgagcgcagcgacgtgcgctacgcccag
ctggaccccagccaggtgccgctgaccgaatgcctgaaggacacggtggcccgcgtgctg
ccgttctggaacgagtccatcgcgcccgccatcctgtccggcaagcgcgtcgtggtcgcg
gcccacggcaactccatccgcgcgctgatcaagtacctggacggcatctcggatgacgcc
atcgtcggcgtcaacgtgcccaatggcattccgctggtctatgagctggatgccaatctc
aagcccattcgccactattacctgggcgatgcagaagctgccgccaaggctgcagccgcc
gtggccgcacagggcaaggcctga

DBGET integrated database retrieval system