KEGG   Delftia sp. Cs1-4: DelCs14_5001Help
Entry
DelCs14_5001      CDS       T01497                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
del  Delftia sp. Cs1-4
Pathway
del00071  Fatty acid degradation
del00280  Valine, leucine and isoleucine degradation
del00281  Geraniol degradation
del00310  Lysine degradation
del00360  Phenylalanine metabolism
del00362  Benzoate degradation
del00380  Tryptophan metabolism
del00410  beta-Alanine metabolism
del00627  Aminobenzoate degradation
del00640  Propanoate metabolism
del00650  Butanoate metabolism
del00903  Limonene and pinene degradation
del00930  Caprolactam degradation
del01100  Metabolic pathways
del01110  Biosynthesis of secondary metabolites
del01120  Microbial metabolism in diverse environments
del01130  Biosynthesis of antibiotics
del01212  Fatty acid metabolism
Module
del_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:del00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    DelCs14_5001
   00650 Butanoate metabolism
    DelCs14_5001
  Lipid metabolism
   00071 Fatty acid degradation
    DelCs14_5001
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DelCs14_5001
   00310 Lysine degradation
    DelCs14_5001
   00360 Phenylalanine metabolism
    DelCs14_5001
   00380 Tryptophan metabolism
    DelCs14_5001
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DelCs14_5001
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    DelCs14_5001
   00281 Geraniol degradation
    DelCs14_5001
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DelCs14_5001
   00627 Aminobenzoate degradation
    DelCs14_5001
   00930 Caprolactam degradation
    DelCs14_5001
Enzymes [BR:del01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     DelCs14_5001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: AEF91972
JGI: DelCs14_5001
UniProt: F6AUE5
Position
5624714..5625493
Genome map
AA seq 259 aa AA seqDB search
MAYEMIEVRVEADKVGIITLNRPKQLNALNDQLMDELGQALQAFDADEAIGCMIITGSEK
AFAAGADIGAMAKYSFADAYKGDYITRNWEAIRSIRKPVIAAVSGFALGGGCELAMMCDF
IIAADNAKFGQPEIKLGVIPGAGGTQRLPRAVGKSKAMDMALTARMMDATEAERAGLVSR
VVPFDKLMDEALGAAIIISGFSQIAVMAAKESVNRAFEGSLADGVMFERRLFHALFATQD
QKEGMDAFVNKRPASFKHL
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
ttggcctacgaaatgattgaagttcgcgtcgaagccgacaaggtcggcatcatcacgctc
aaccgccccaagcagctcaacgcgctcaatgaccagctcatggacgagctgggccaggcc
ctgcaggccttcgatgccgatgaggccatcggctgcatgatcatcaccggcagcgagaaa
gcctttgcggctggcgccgacatcggcgccatggccaagtacagctttgccgacgcctac
aagggcgactacatcacgcgcaactgggaagccatccgctccatccgcaagcccgtgatc
gccgccgtcagcggcttcgcactgggcggcggctgcgagctggccatgatgtgcgacttc
atcatcgccgccgacaatgcgaagttcggccagccggaaatcaagctgggcgtgatcccc
ggcgccggcggcacgcagcgcctgccgcgcgccgtgggcaagtccaaggccatggacatg
gccctcacggcccgcatgatggacgccaccgaagccgagcgcgccggtctggtcagccgc
gtcgtgcccttcgacaagctcatggacgaggcgctgggcgccgccatcatcatcagcggc
ttctcgcagattgccgtcatggcggccaaggaatcggtgaaccgcgccttcgagggctcg
ctggccgacggcgtcatgttcgagcgccgcctgttccacgcgcttttcgccacccaggac
cagaaggaaggcatggacgccttcgtcaacaagcgtcccgccagcttcaagcatctctga

DBGET integrated database retrieval system