KEGG   Delftia sp. Cs1-4: DelCs14_5239Help
Entry
DelCs14_5239      CDS       T01497                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
del  Delftia sp. Cs1-4
Pathway
del00521  Streptomycin biosynthesis
del00523  Polyketide sugar unit biosynthesis
del01130  Biosynthesis of antibiotics
Module
del_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:del00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    DelCs14_5239
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    DelCs14_5239
Enzymes [BR:del01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     DelCs14_5239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: AEF92209
JGI: DelCs14_5239
UniProt: F6AXI9
Position
complement(5895835..5896383)
Genome map
AA seq 182 aa AA seqDB search
MKATPLAIPEVMLIEPKVFGDDRGFFLESFNQQAFNQATGTDHQFVQDNHSRSKKGVLRG
LHYQLPPHAQGKLVRVVRGAVFDVAVDIRKGSPTFGQWVGAELTEDNHRQLWVPPGFAHG
FVVLSDSADFLYKATAFYAPQADRGIAWDDPAIGVQWPQLDVEISLSDKDLRQPLLADAE
LA
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcaacacccctggccatccccgaggtgatgctgatcgagcccaaggtctttggt
gacgatcgcggcttcttcctcgaaagcttcaaccagcaggccttcaaccaagccacgggc
acggaccaccagttcgtgcaggacaaccacagccgcagcaagaagggcgtgctgcgcggc
ctgcactaccagttgcctccccatgcccagggcaagctcgtgcgcgtggtgcgcggcgcc
gtgttcgacgtggccgtggacatccgcaagggctcgccgaccttcggccagtgggtgggc
gccgagctgacggaagacaaccaccgccagctgtgggtgcccccaggctttgcccacggc
ttcgtggtgctcagcgacagcgccgacttcctctacaaggccacggccttctacgcgccc
caggccgatcgcggcattgcctgggacgatccggccatcggtgtgcagtggccgcagctc
gatgtggagatttcgctgtcggacaaggacctcaggcagccgctgctggcggatgccgag
ctggcctga

DBGET integrated database retrieval system