KEGG   Delftia sp. Cs1-4: DelCs14_5393Help
Entry
DelCs14_5393      CDS       T01497                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
del  Delftia sp. Cs1-4
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:del00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    DelCs14_5393
Enzymes [BR:del01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     DelCs14_5393
Exosome [BR:del04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DelCs14_5393
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6072808..6074349
Genome map
AA seq 513 aa AA seqDB search
MHHEAVILCIDEGTSGTRAAVVGRDGQVSAQDYLPLEIHCPRPGVVEQDADLLLERTLDV
CRRAIARAQGCGQQIVALAIANQRCSAVLWDTVTGRSLAPIMVWQDSRHRDELALLAGDW
DARLIRHAGRPVGVRSPYLWAARKLREDAAVARAWQQRRLAFGTIDSWLLWHLSDARAVV
TTPTNVTSGNAYALGEHRYLQDWLDALEFPAELLPRLCEDVQDFGRTRSELLGLAVPILA
CAGDQHAAAVGLGCLERGQALCVHGTGSFVDVLTGTKLPAHDAAHESSLTMTARRMGGVS
RYAIETYVPTTGSALNWICEKLQWFDNPQQISTLAREAETPADLVFIPALTGLRLPAMEP
GARASISGVSMATSRPQLARSILEGIAHSVASCVQADEAAAGTEVGELLVGGGLSGSDAL
LQIQADLGGLPVRRLADTDKASLRGIAFMAGSAGLLWDGLEQACATLRTEAVFTPRMATD
ERGERRRIWRARVGDELARARAPGRSAALEGCA
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgcaccatgaagccgtgatcctttgcatagacgaaggcacctcgggcacgcgcgccgcc
gtcgtgggacgcgacgggcaggtgtccgcccaggactatctgccgctggaaatccactgc
ccgcgccccggcgtggtcgagcaggacgccgacctgctgctggagcgcacgctggacgtg
tgccgccgcgccatcgcccgcgcccagggctgcggccagcagatcgtggccctggccatt
gccaaccagcgctgctcggccgtgctctgggacacggtcacaggccggtcgctagcgccc
atcatggtctggcaggactcgcgccaccgcgacgaactggccctgctggccggcgactgg
gatgcccggctgatccgccacgcgggccggcccgtgggcgtgcgttcgccctacctgtgg
gccgcgcgcaagctgcgtgaggatgcggccgtagcccgtgcctggcagcagcgccgcctg
gccttcggcaccatcgactcctggctgctgtggcatctgtcggatgcgcgcgccgtggtc
accacgcccaccaatgtgacctcgggcaacgcctatgcgctgggcgagcatcgctatctg
caggactggctggacgcgctggagtttcccgccgagctgctgccccgcctgtgcgaggac
gtgcaggacttcggccgcacgcgcagcgagctgctgggcctggccgtgcccatcctggcc
tgcgcgggcgaccagcatgcggccgccgtgggcctgggctgcctggagcggggccaggcg
ctgtgcgtgcatggcacgggcagcttcgtcgatgtgctcacgggaacaaagctgcccgcg
catgacgcagcccatgaaagctcgctgaccatgaccgcgcggcgcatgggcggtgtctcg
cgctatgccatcgagacctatgtgcccaccaccggctcggcgctcaactggatctgcgag
aagctgcagtggttcgacaacccgcagcagatcagcaccctggcccgcgaggccgagacg
ccggccgacctggtcttcatccccgcgctcacgggcctgcgcctgccggccatggagccg
ggcgcgcgggcctcgatctcgggcgtgtccatggccacctcgcggccgcagctggcgcgc
tccatcctcgaaggcattgcgcattccgtggcctcctgcgtgcaggccgacgaggcggcc
gcaggcaccgaggtgggcgagctgctggtgggcggcggcctgtcgggcagcgatgcgctg
ctgcagatccaggccgacctgggcggcctgcccgtgcgccgcctggccgataccgacaag
gccagcctgcgcggcatcgccttcatggccggcagcgcaggcctgctgtgggacgggctg
gagcaggcctgcgccacgctacgcaccgaagcggtcttcaccccgcgcatggccaccgac
gagcgcggcgagcgccgccgcatctggcgcgcccgcgtgggcgacgaactggcccgcgcc
cgggcccccgggcgcagcgccgcactggagggctgcgcatga

DBGET integrated database retrieval system