KEGG   Delftia sp. Cs1-4: DelCs14_5499Help
Entry
DelCs14_5499      CDS       T01497                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
del  Delftia sp. Cs1-4
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:del00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6191268..6192764
Genome map
AA seq 498 aa AA seqDB search
MTYLLALDQGTSSSRSIVFDTQGRIVASAQLELPQIYPRPGWVEHDPREIWRTQLATARE
ALTKAGLAAADIRALGITNQRETTVVWNRATGQPIHHAIVWQDRRAEPLCAQLREAGHAD
TIQRKTGLLIDAYFSGTKLRWILDNVNGARAAAERGELAFGTVDSWLIWQLTGGRRHVTD
VSNASRTMLFNVHTNQWDDDLLALLEIPRALMPEVLPSAADFGRTAAEVLGGEIAIGGVA
GDQQSALFGQACFSAGMAKNTYGTGCFMLMHTGGVFQTSANGLLTTAAAQPTAAPAYALE
GSVFVGGAVVQWLRDGLRAIEHSGQVQQLAESVPDSGGVMMVPAFTGLGAPYWKPDARGT
ITGLTRGTTIAHIARAALESIAFQSAALLLAMSRDAVASGGAPVSELRVDGGACVNNLLM
QFQADLLGIPVVRPACVETTALGAAYLAGLSSGVYQSTEELSALWKAERRFVPTLDKHRA
DELMARWEHAVAQTALAA
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgacctatctgcttgccctggaccagggcacctccagctcgcgcagcatcgtcttcgac
acccagggccgcatcgtggcctcggcccagctggagctgccgcagatctatccccggccc
ggctgggtcgaacacgatccgcgcgagatctggcgcacccagttggccacggcgcgcgag
gccctgaccaaggccgggctggcggctgccgacatccgcgccctgggcatcaccaaccag
cgcgagaccaccgtggtctggaaccgcgccacgggccagcccatacaccacgccatcgtc
tggcaggaccgccgcgccgagccgctgtgcgcccagctgcgcgaggccggacatgccgac
accatccagcgcaagaccggcctgctgatcgacgcctatttctcgggcaccaagctgcgc
tggattctggacaacgtcaacggcgcgcgcgccgccgccgagcgcggcgaactggccttc
ggcaccgtggacagctggctgatctggcagctcacgggcggacgccgccatgtgaccgat
gtctccaacgccagccgcaccatgctgttcaacgtccacaccaaccagtgggacgacgat
ctgctggcgctgctggagattccgcgcgcgctgatgcccgaggtgctgccttccgccgcc
gatttcggccgcacggcagccgaggtgctgggcggcgagatcgccattggcggtgtggcc
ggcgaccagcaaagcgccctcttcggccaggcctgcttttcggccggcatggccaagaac
acctatggcacgggctgcttcatgctcatgcacacgggcggcgtgttccagacctccgcc
aacggcctgctgaccaccgctgcggcacagcccaccgctgcgccggcctatgcgctggaa
ggcagcgtcttcgtgggcggcgccgtggtccagtggctgcgcgacgggctgcgcgccatc
gagcacagcggccaggtgcagcaactggccgagagcgtgcccgactcgggcggcgtgatg
atggtgccagccttcacgggcctgggcgccccctactggaagcccgatgcgcgcggcacc
atcacgggcctgacgcgcggcaccaccattgcccacatcgcgcgggccgcgcttgaatcc
attgccttccagagcgccgccctgctgctggccatgagccgcgacgcggtggccagcggc
ggcgcgccggtgagcgaactgcgcgtggacggcggcgcctgcgtcaacaacctgctcatg
cagttccaggccgacctgctgggcattcccgtcgtgcgcccggcctgcgtggagaccacg
gccctgggcgctgcctacctggcaggcctgtcctcgggcgtgtaccagagcaccgaggaa
ctgtcggcgctgtggaaggccgagcgccgcttcgtgcccacgctggacaagcaccgcgcc
gacgagctgatggcgcgctgggagcatgcggtggcccagaccgcgctggcggcctga

DBGET integrated database retrieval system