KEGG   Delftia sp. Cs1-4: DelCs14_5638Help
Entry
DelCs14_5638      CDS       T01497                                 

Definition
peroxiredoxin (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
del  Delftia sp. Cs1-4
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:del00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:del00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(6337986..6338492)
Genome map
AA seq 168 aa AA seqDB search
MNDTAAAPRSAYDFEATSITGQAVPLSDYRGKVLLIVNTASACGFTPQYAGLQALHEQYG
ERGLVVLGFPCNQFGSQEKGSESEIASFCDLNFGVRFPLMGKIDVNGANAHPLYRWLTAE
APGVLGTKAIKWNFTKFLVGRDGQVIRRYAPQDAPAKLSTDIEAALAL
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgaatgacaccgccgccgcgccccgctcggcctacgacttcgaggccacctccatcacg
ggccaggccgtccccctgtcggactaccgcggcaaggtgctgctcatcgtcaacaccgcc
agcgcctgcggcttcacgccgcagtacgccggcctgcaggcgctgcatgagcagtacggc
gagcgcggcttggtggtgctgggctttccgtgcaaccagttcggttcccaggaaaagggc
agcgaatcggaaattgccagcttctgcgacctgaactttggcgtgcgctttccgctcatg
ggcaagatcgacgtcaacggcgccaacgcccacccgctgtaccgctggctcacggccgag
gcgccgggcgtgctcggcaccaaggccatcaagtggaacttcaccaaattcctcgttggc
cgcgacggccaggtcatccgccgctatgcgccgcaggatgcgccggccaagctgtccacg
gacatcgaggccgcgctggcgctttga

DBGET integrated database retrieval system