KEGG   Delftia sp. Cs1-4: DelCs14_5657Help
Entry
DelCs14_5657      CDS       T01497                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
del  Delftia sp. Cs1-4
Pathway
del00020  Citrate cycle (TCA cycle)
del00640  Propanoate metabolism
del00660  C5-Branched dibasic acid metabolism
del01100  Metabolic pathways
del01110  Biosynthesis of secondary metabolites
del01120  Microbial metabolism in diverse environments
del01130  Biosynthesis of antibiotics
del01200  Carbon metabolism
Module
del_M00009  Citrate cycle (TCA cycle, Krebs cycle)
del_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:del00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DelCs14_5657
   00640 Propanoate metabolism
    DelCs14_5657
   00660 C5-Branched dibasic acid metabolism
    DelCs14_5657
Enzymes [BR:del01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     DelCs14_5657
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AEF92627
JGI: DelCs14_5657
UniProt: F6AMR8
Position
6360899..6362059
Genome map
AA seq 386 aa AA seqDB search
MKIHEYQGKDILRQFGVPVPRGIPAFTVQEAVEAAQKLGGPVWVVKAQIHAGGRGKGGGV
KVAKSIDDVKALAGQILGMQLVTHQTGPEGQKVRRLYIEDGADIQKEYYLSCVTDRGTQK
VAFIASSEGGMDIEEVAHSTPEKIITIFVDPLVGLTQAQGEELAKGIGMPADSTAQFIDI
CQKLYKCYMDTDASLVEINPLNRDSKGNVVALDAKFNFDANALFRLPEIVALRDLDEEDP
AEVEASKFDLAYISLDGNIGCLVNGAGLAMATMDTIKLFGGEPANFLDVGGGATPEKVTE
AFKIMLKNPKVEGILVNIFGGIMKCDTIATGVITACKAVNLQVPLVVRMKGTNEELGKKM
LAESGLPIISADTMAEAATKIVEAVK
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcatgaataccaaggcaaggacatcttgcgtcagtttggtgtgcctgtacct
cgcggtatccctgcgttcacagtgcaagaggccgtcgaggccgcccagaagctcggcggc
cccgtgtgggtcgtgaaggcccagatccacgctggtggtcgcggcaagggcggcggcgtg
aaggttgccaagagcattgacgacgtcaaggcactggctggccagatcctgggcatgcag
ctggtcacgcaccagaccggccccgaaggccagaaggtccgccgcctgtacatcgaagac
ggcgccgacatccagaaggaatactacctgtcgtgcgtgaccgatcgcggcacgcagaag
gtggccttcatcgcttccagcgaaggcggcatggacatcgaggaagtggcccactccact
cccgagaagatcatcaccatcttcgttgaccccctggtcggcctgacccaggcccagggc
gaagaactggccaagggcatcggcatgcctgccgactccaccgcccagttcatcgacatc
tgccagaagctctacaagtgctacatggacacggatgcctcgctggtcgagatcaacccg
ctgaaccgtgacagcaagggcaacgtggttgccctggacgcgaagttcaacttcgacgcc
aacgccctgttccgcctgcccgaaatcgtggccctgcgcgacctggacgaagaagatccc
gctgaagtcgaagcctccaagttcgatctggcctacatctcgctggacggcaacatcggc
tgcctggtcaacggtgcaggtctggccatggccaccatggacaccatcaagctgttcggc
ggcgagccggccaacttcctggacgtgggcggcggcgccacccccgagaaggtcaccgaa
gccttcaagatcatgctcaagaaccccaaggtcgaaggcattctggtcaacatcttcggc
ggcatcatgaagtgcgacaccatcgccactggcgtgatcactgcctgcaaggccgtgaac
ctgcaagtgcccctggtcgtgcgcatgaagggcacgaacgaagaactgggcaagaagatg
ctggccgagtccggcctgcccatcatcagcgccgacacgatggccgaagcggccaccaag
atcgtcgaagccgtcaagtaa

DBGET integrated database retrieval system