KEGG   Delftia sp. Cs1-4: DelCs14_5767Help
Entry
DelCs14_5767      CDS       T01497                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
del  Delftia sp. Cs1-4
Pathway
del00400  Phenylalanine, tyrosine and tryptophan biosynthesis
del01100  Metabolic pathways
del01110  Biosynthesis of secondary metabolites
del01130  Biosynthesis of antibiotics
del01230  Biosynthesis of amino acids
Module
del_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:del00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DelCs14_5767
Enzymes [BR:del01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     DelCs14_5767
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AEF92736
JGI: DelCs14_5767
UniProt: F6ANW5
Position
complement(6483971..6484774)
Genome map
AA seq 267 aa AA seqDB search
MSDILKQICDVKVQEVAAAQKRMPFADMRRDAESRVLTRDFVGALRAKIAASHAGVIAEI
KKASPSKGVIREDFIPADIAQSYADGDGKGVSAACLSVLTDKQFFQGSVDYLKQARASCH
LPVLRKDFMVDPYQIYESRAMGADCVLLIAACLDDAQMAEMEQIAHSLDMAVLVEVHDGA
ELDRALRLKTPLVGINNRNLRSFEVSIQTTLDLQKNVPADRLLVTESGIGSREDVKAMRD
AGIHSFLVGEAFMRAKEPGEALAKLFA
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgacatcctcaagcaaatctgcgacgtgaaagtgcaggaagtggccgccgcccag
aagcgcatgcccttcgcggacatgcgccgcgacgccgaaagccgcgtgctcacgcgcgac
ttcgtgggcgcgctgcgcgccaagatcgccgccagccatgccggcgtgatcgccgagatc
aagaaggccagccccagcaagggcgtgatccgcgaggacttcatccccgccgacatcgcg
caaagctatgccgatggcgacggcaagggcgtcagcgccgcctgcctctcggtgctgacc
gacaagcagttcttccagggcagcgtggactatctcaagcaggcgcgcgccagctgccac
ctgcccgtgctgcgcaaggatttcatggtcgatccctaccagatctacgaatcgcgggcc
atgggcgccgactgcgtgctgctgatcgccgcctgcctggacgacgcgcagatggccgag
atggaacagatcgcccacagcctggacatggccgtgctggtcgaggtccatgacggcgcc
gagctggaccgcgccctgcggctcaagacgccgctggtgggcatcaacaaccgcaacctg
cgcagcttcgaggtcagcatccagaccacgctggacctgcaaaagaacgtgcccgccgac
cgcctgctggtcaccgagtcgggcatcggcagccgcgaggacgtcaaggccatgcgcgat
gccggcatccacagcttcctggtgggcgaggccttcatgcgcgccaaggagccgggagag
gcgctggccaagctgtttgcctaa

DBGET integrated database retrieval system