KEGG   Delftia sp. Cs1-4: DelCs14_5850Help
Entry
DelCs14_5850      CDS       T01497                                 

Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
del  Delftia sp. Cs1-4
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:del01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:del00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6579840..6580805
Genome map
AA seq 321 aa AA seqDB search
MGPMSMNTHTTPQTARALRLIGVPTDIGASRLGSAMGPDALRVAGLGPALRQLGCQVSDI
GNLAGPPNPQTPPEQGLRHLAPARAWMDAVHQAVGRALDDGELPLMLGGDHSLAMGSISA
VAAHCRRRGRALRVIWLDAHADCNTPDISPSGNLHGMPVASLCGLGPAALTALSQGGDPA
LAAASLCQIGLRSVDDQEKRLLYSLGVEVYDMRAIDELGMREVMRRALEDLEGSDTHLHL
SFDVDYLDPDIAPGTGTPVRGGPSYREAQLCMEMLADTGRLGSMDLVELNPALDVRNQTA
ELVVDLLESLFGKSTLVRADR
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgggtcccatgagcatgaacacccatacgaccccgcagaccgcgcgcgccctgagactc
ataggcgtgcccaccgacatcggcgccagccgcctgggcagcgccatggggccggacgca
ctgcgcgtggccggcctgggcccggcgctgcgccagctgggctgccaggtgagcgacatc
ggcaatctggcaggcccgcccaatccgcagacaccgcccgagcaggggctgcgccacctc
gcaccggcccgcgcctggatggacgccgtgcaccaggccgtgggccgggcgctggacgac
ggcgagctgccgctgatgctgggcggcgaccacagcctggccatgggctcgatcagcgcc
gtggccgcccactgccgccgacggggccgcgcgctgcgcgtgatctggctggacgcgcac
gccgactgcaacacgcccgatatctcgcccagcggcaacctgcacggcatgcccgtggcc
agcctgtgcggcctggggcccgcggcgctcaccgcgctgtcccagggcggcgatccggcg
ctggcagccgcctcgctgtgccagatcggcctgcgcagcgtggatgaccaggaaaagcgc
ctgctgtattcgctgggcgtggaggtctatgacatgcgcgccatcgacgagctgggcatg
cgcgaggtcatgcgccgcgcgctggaagacctggaaggcagcgacacccacctgcacctg
agcttcgacgtggactacctcgatcccgacatcgcgcccggcaccggcacccccgtgcgc
ggcggccccagctaccgcgaggcccagctgtgcatggagatgctggccgacaccggacgc
ctgggctcgatggatctggtggagctcaatcccgcgctggatgtgcgcaaccagacggcc
gaactggtggtggacctgctggagagcctgttcggcaagagcacgctggtgcgggccgat
cgctga

DBGET integrated database retrieval system