KEGG   Delftia sp. Cs1-4: DelCs14_5850Help
Entry
DelCs14_5850      CDS       T01497                                 

Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
del  Delftia sp. Cs1-4
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:del00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DelCs14_5850
  Amino acid metabolism
   00330 Arginine and proline metabolism
    DelCs14_5850
Enzymes [BR:del01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     DelCs14_5850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6579840..6580805
Genome map
AA seq 321 aa AA seqDB search
MGPMSMNTHTTPQTARALRLIGVPTDIGASRLGSAMGPDALRVAGLGPALRQLGCQVSDI
GNLAGPPNPQTPPEQGLRHLAPARAWMDAVHQAVGRALDDGELPLMLGGDHSLAMGSISA
VAAHCRRRGRALRVIWLDAHADCNTPDISPSGNLHGMPVASLCGLGPAALTALSQGGDPA
LAAASLCQIGLRSVDDQEKRLLYSLGVEVYDMRAIDELGMREVMRRALEDLEGSDTHLHL
SFDVDYLDPDIAPGTGTPVRGGPSYREAQLCMEMLADTGRLGSMDLVELNPALDVRNQTA
ELVVDLLESLFGKSTLVRADR
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgggtcccatgagcatgaacacccatacgaccccgcagaccgcgcgcgccctgagactc
ataggcgtgcccaccgacatcggcgccagccgcctgggcagcgccatggggccggacgca
ctgcgcgtggccggcctgggcccggcgctgcgccagctgggctgccaggtgagcgacatc
ggcaatctggcaggcccgcccaatccgcagacaccgcccgagcaggggctgcgccacctc
gcaccggcccgcgcctggatggacgccgtgcaccaggccgtgggccgggcgctggacgac
ggcgagctgccgctgatgctgggcggcgaccacagcctggccatgggctcgatcagcgcc
gtggccgcccactgccgccgacggggccgcgcgctgcgcgtgatctggctggacgcgcac
gccgactgcaacacgcccgatatctcgcccagcggcaacctgcacggcatgcccgtggcc
agcctgtgcggcctggggcccgcggcgctcaccgcgctgtcccagggcggcgatccggcg
ctggcagccgcctcgctgtgccagatcggcctgcgcagcgtggatgaccaggaaaagcgc
ctgctgtattcgctgggcgtggaggtctatgacatgcgcgccatcgacgagctgggcatg
cgcgaggtcatgcgccgcgcgctggaagacctggaaggcagcgacacccacctgcacctg
agcttcgacgtggactacctcgatcccgacatcgcgcccggcaccggcacccccgtgcgc
ggcggccccagctaccgcgaggcccagctgtgcatggagatgctggccgacaccggacgc
ctgggctcgatggatctggtggagctcaatcccgcgctggatgtgcgcaaccagacggcc
gaactggtggtggacctgctggagagcctgttcggcaagagcacgctggtgcgggccgat
cgctga

DBGET integrated database retrieval system