KEGG   Delftia sp. Cs1-4: DelCs14_5866Help
Entry
DelCs14_5866      CDS       T01497                                 

Definition
Malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
del  Delftia sp. Cs1-4
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:del01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:del00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:del00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6597320..6599512
Genome map
AA seq 730 aa AA seqDB search
MTDRTQAHSLQVATELHRFINEQVLPGTGVAPEAFWKGFDAIVNDLAPRNAALLAERDRL
QTELDTWHKAHPGPITDMAGYQQFLTQIGYLVEQPKDAKATTTNVDAELAIQAGPQLVVP
ILNARYALNAANARWGSLYDALYGTDAIGEDGGAEKGKGYNPVRGAKVIAFARDFLDQAA
PLASGSHKDAAGYRVEAGQLVVALKSGGTTGLKNTAQFVGYQGDAAAPSSVLLLNNGLHI
DIRIDKTTAIGQTDAAGVADVVVEAALSTILDLEDSVAAVDAEDKVVGYANWLGILKGTL
TETFDKGGKSMTRGLNADREYTGADGKPVKLHGRSLMFVRNVGHLMTNPAILWGNGKEIP
EGILDAMVTTAIAVHDIKGLGANGIRNSRTGSVYIVKPKMHGPAEAAFASELFGRVEKVL
GLPENTVKLGIMDEERRTSVNLKACIAAAASRVAFINTGFLDRTGDEIHTAMYAGPMVRK
ADMKGSAWLAAYERSNVLVGLGLGLRGKAQIGKGMWAMPDLMKAMLEQKIGHPKAGANTA
WVPSPTAATLHALHYHQVNVAEVQKQLEQTNADAERATILADLLQVPVVKEDKWSAAEKQ
QELDNNVQGILGYVVRWVDQGVGCSKVPDIHNVGLMEDRATLRISSQHIANWLQHGIVTE
AQVRETFERMAAVVDQQNAGDALYKPMAGHFDTSMAYQAACDLVFKGKEQPSGYTEPLLH
AWRLKVKAAA
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcgcacccaagcccacagcctgcaggtcgctacagagctgcaccgtttcatc
aatgaacaagtgctcccgggcaccggtgtcgctcccgaggcgttctggaaaggcttcgac
gcgatcgtcaacgatctggctcctcgcaatgccgccctgctggccgagcgtgaccgcctg
cagaccgagctggacacctggcacaaggcccatcccggccccatcaccgacatggccggc
taccagcaattcctgacgcagatcggctatctggtcgagcagcccaaggatgccaaggcc
accaccaccaatgtggatgcggaactggccatccaggccggcccccagctggtcgtgccc
attctcaacgcccgctatgcgctgaacgccgccaacgcgcgctggggttcgctgtatgac
gcgctgtacggcacggacgccatcggcgaagacggtggcgcggaaaagggcaagggctac
aaccccgtgcgcggcgccaaggtgatcgccttcgcacgtgatttcctggaccaggcagcc
ccgctggcatcgggctcgcacaaggatgccgccggctatcgcgtggaagctggccagctg
gtcgtcgcactcaagagcggcggcaccacgggcctgaagaacaccgcccagttcgtcggc
taccagggtgatgccgcggcgccctcttccgtgctgctgctcaacaacggcctgcacatc
gacatccgcatcgacaagaccacggccatcggccagaccgatgccgccggcgtggccgac
gtggtggtcgaagccgccctgtccaccatcctggacctggaagactccgtggccgccgtg
gatgccgaggacaaggtggtcggctatgccaactggctgggcatcctcaagggcacgctg
accgaaaccttcgacaagggcggcaagagcatgacgcgcggcctgaacgccgaccgcgag
tacacgggcgccgatggcaagcccgtcaagctgcatggccgttcgctgatgttcgtgcgc
aatgtcggccacctgatgaccaacccggccatcctctggggcaatggcaaggaaatcccc
gagggcatcctggacgccatggtcaccacggccattgccgtccacgacatcaagggtctg
ggcgccaacggcatccgcaactcgcgcacgggcagcgtctacatcgtcaagcccaagatg
cacggccccgcggaagccgccttcgccagcgagctgttcggccgcgtggaaaaggtgctg
ggcctgcccgagaacaccgtcaagctgggcatcatggacgaggagcgccgcaccagcgtc
aacctcaaggcctgcattgccgccgccgcatcgcgcgtggccttcatcaacaccggcttc
ctggaccgcacgggcgacgaaatacacaccgccatgtatgccggccccatggtccgcaag
gccgacatgaagggcagcgcctggctggccgcctatgagcgcagcaacgtgctcgtgggc
ctgggcctgggcctgcgcggcaaggcgcagatcggcaagggcatgtgggccatgcccgac
ctgatgaaggccatgctggagcaaaagatcggccaccccaaggccggcgccaataccgcg
tgggtaccctcgcccacggccgccacgctgcacgccctgcactaccaccaggtcaacgtg
gccgaagtgcaaaagcagctggagcagaccaatgccgacgccgagcgcgccaccatcctg
gccgacctgctgcaggtgcccgtggtcaaggaagacaagtggagcgcggctgaaaagcag
caggagctggacaacaacgtccagggcatcctcggctatgtggtgcgctgggtggaccag
ggcgtgggctgctccaaggtgcccgacatccacaacgtgggcctgatggaagaccgcgcc
acgctgcgcatctccagccagcacatcgccaactggctgcagcacggcatcgtgaccgag
gcccaggtgcgcgagaccttcgagcgcatggccgccgtggtcgaccagcagaacgcgggc
gatgcgctgtacaagcccatggccggccacttcgacacctcgatggcctaccaggccgcc
tgtgacctggtcttcaagggcaaggagcaacccagtggctacaccgagcccctgctgcat
gcctggcgcctgaaggtcaaggcagccgcctga

DBGET integrated database retrieval system