KEGG   Delftia sp. Cs1-4: DelCs14_5908Help
Entry
DelCs14_5908      CDS       T01497                                 

Definition
guanine-specific ribonuclease N1 and T1
Orthology
K01167  
ribonuclease T1 [EC:3.1.27.3]
Organism
del  Delftia sp. Cs1-4
Brite
Enzymes [BR:del01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.3  ribonuclease T1
     DelCs14_5908
Messenger RNA biogenesis [BR:del03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     DelCs14_5908
Transfer RNA biogenesis [BR:del03016]
 Eukaryotic Type
  3'processing and CCA adding factors
   3'processing factor
    DelCs14_5908
 Prokaryotic Type
    DelCs14_5908
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6659185..6659604
Genome map
AA seq 139 aa AA seqDB search
MLKAAAAKAYQSGLALIVGAAFVLSPSLADARRSAPESVETTAAVATVALSELPREGRST
YTLILRGGPFAHDKDGTVFGNRERILPRQSRGYYREYTVRTPGSRDRGARRIVCGGEPQQ
PDACYYTSDHYSSFRKIIE
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaggcagccgccgccaaggcgtaccagtccggtctagcgctcatcgtcggggcc
gcctttgtgctgtcgccctcgctcgctgatgcgcgccgctcggcgcccgagagcgtggag
acgacggcggccgtggccaccgtcgccctgtccgagttgccgcgcgaaggccgttccacg
tatacgctgatcctgcgcggcgggccttttgcccacgacaaggacggcacggtgttcggc
aaccgcgagcgcatcctgccgcgtcagtcgcgcggctattaccgtgagtacacggtgcgc
acgcccggttcgcgtgaccgtggggcccgtcgcatcgtctgcggcggagagccccagcag
cccgatgcctgctactacaccagcgaccactacagcagctttcgcaagatcatcgaatga

DBGET integrated database retrieval system