KEGG   Drosophila erecta: Dere_GG10087Help
Entry
Dere_GG10087      CDS       T01060                                 

Definition
GG10087 gene product from transcript GG10087-RA
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
der  Drosophila erecta
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1008 aa AA seqDB search
MACFPRLFHHRSKNKFTPAKDENTDTILNTQDSPVQIGQYIRREEKPLYSPIVTPSASEA
KLQRLRQQPPGSPPAPARCTLQSVAERGSAHNGVQELKFLSKKDKLQTQDVSSSGGSAIN
VTRSSSKLKPVKERRPTALPTEVPSIEIEDEQAALDAEDAGDGQDSLEEGVALQPGANAH
VDVVDVVDGGKSKLKVNVNGIIDEGVAHDDDDVATPSSTSTATTPVTEGPVKFFIGHTQE
LGAQQTDDTLSWQSSDANNNSSHAAKLTNGVLPQEQQEQGREQDSRGSLQAPLQAPPRAK
SSSNVSLNYPAKSQTDSQHRRRVSTMPDINIPPAPPLPPELLVPGTPLHLRKKRSVERPQ
QEQQLENQQDASNSQDQIAGREKSSDSSTPKTHRVEGGLIYVRPNFPIQGDIEIESIAKD
EGTRNLIRTAIERNDFLNNLMDKERKEMVINAMAPASYRKHSLIIREHEEGSEIYVSAEG
QYDVIRGGQLVASFGPATVFGELAILYNAPRQASVEAATDARVWKIARETFRAIMQISGS
REREENLQFLRSAPFLQEFDQSLLLKVVDLLQRKFYETDSCIVREGELGNEFYIIRCGTV
TIKKRDNQQQEQIVANRKRGDYFGEQALLNADVRQASVYADAPGTEVLMLDREAFISYLG
TIKQLREKPSGQRGDTSGRSSSKSLEFDNEYSQVAISELKKIATLGCGAFGRVDLVAYNQ
QALALKIIKKIEVVKQDQIEHVYNEKNVMIKCRQSPFIVQLYRTYRNDKYVYFLMEACMG
GDVWTVMSKRQYFDEKTAKFIAGCVVEAFDYLHSHHFIYRDLKPENLMLGTDGYCKLVDF
GFAKFVRHNEKTNTFAGTPEYVAPEIILDRGHDRAVDYWALGILVYELLVGKTPFRGVNQ
IKIYQQILSGIDVIHMPSRIPKSAQHLVRHLCKQLPAERLGYQRKGIADIKRHSWFESLD
WQRLKQKQLPSPIKRPLKSWTDLQYFGPSGVENDYEPPEELSGWDQEF
NT seq 3027 nt NT seq  +upstreamnt  +downstreamnt
atggcctgctttccccgacttttccatcatcgcagcaaaaacaaattcactcccgccaaa
gatgagaacaccgatacgatactcaacacacaagatagtcccgtgcaaattggccagtac
atccgtcgcgaggagaagccactgtactcgcccatcgtcactccgagtgccagtgaggcc
aaacttcagcgcctcaggcagcagccgcccggctcgccgcccgcccccgccaggtgtacc
ctgcagtcggtggccgaaagaggcagcgcacacaatggcgtccaggagctgaagttcctc
tccaagaaggacaagctgcagacgcaggatgtgtcctcttccggcggcagtgcaattaat
gtcacacgctcaagttcgaaattaaaaccagtcaaagagcgtcggcccaccgccttgccc
accgaggtgcccagcatcgagatcgaggatgagcaggctgcgctagatgcagaggacgca
ggggatggccaggattcgctggaggagggggtggcgctgcagccgggtgctaatgcacat
gtcgatgtcgtcgatgtcgtcgatggcggcaagtcaaaactcaaagtgaatgtgaatggc
ataattgatgagggcgtcgcccacgacgacgacgatgttgccacaccctcgagcacctcc
acagccacaacacctgtgaccgagggtcctgtaaagttcttcattggtcacacgcaggaa
ctaggcgcccagcaaacggatgacaccttgtcctggcagagcagcgatgccaacaacaac
agcagccacgccgccaaactgacaaatggcgtcctgccacaggagcaacaggaacagggc
agggaacaggactccagggggagcctgcaagcaccactccaggctccgccccgcgccaag
agctccagcaacgtgtcactcaattatccggccaagagccagacggacagccagcaccgc
cgacgtgtgtccacgatgcccgatattaacataccgccggcaccgccgttgcctccggaa
ctcctcgtccccggaacgccgctccatctgcgcaagaagcggagcgtggagcgaccgcag
caggagcagcagctggagaaccagcaggatgcttcgaatagtcaagatcaaatagcagga
agagagaagtccagcgattcttcgacaccaaaaacacatcgcgtggaaggtggcctcatc
tatgtccgtcccaattttcccattcagggtgacattgaaatcgaatctattgcaaaggac
gaaggcacacgcaatctcatacgaacggccattgagcgcaatgatttcctcaataatcta
atggacaaggagcgcaaggagatggttatcaatgcaatggccccggccagctacaggaag
cacagcctcatcatccgggagcacgaggagggctccgagatatatgtctccgccgagggc
cagtacgatgtcatccgtgggggccaactggtggccagctttggaccagccaccgtgttc
ggtgaactggccatcctctacaatgctccgcgccaggcgtccgtagaggctgccaccgat
gcacgggtttggaaaatcgcacgcgaaaccttcagggccatcatgcaaatctctgggtcc
agggaacgcgaggagaacctccagttcttgcgctccgctcctttcctgcaggagttcgac
caaagtttgctgctcaaagtcgtggatcttctgcagaggaaattctacgagaccgacagc
tgcattgtccgcgaaggtgagctgggcaacgagttctacatcatccggtgcggcactgtg
accattaagaagcgggacaaccagcagcaggagcagattgtggccaaccgaaagcgcggt
gactacttcggggagcaggccctgctcaatgcggatgtgcgtcaggccagtgtctatgcg
gatgccccgggcaccgaggtcctcatgctggacagagaagccttcattagctatttggga
accataaagcagctgcgcgagaagcccagtggtcagcgcggggatacgagtggccggtcc
agcagcaagtccctggagttcgacaacgagtactcccaagtggccatctcggagctgaag
aagatagccacgctgggctgcggagcctttggccgcgtggacctggtggcctacaaccaa
caggcgttggcactgaagatcatcaagaaaatcgaggtggtcaagcaagatcaaatagag
cacgtttacaacgagaagaacgtcatgattaagtgccgtcaatcgcccttcatagtacaa
ctctatcgcacgtaccgcaatgacaagtacgtttacttcctaatggaggcgtgcatgggc
ggtgatgtatggacggtgatgtcaaagcgccagtacttcgatgagaagaccgccaaattt
atagcgggctgtgtcgtggaggccttcgattacttgcactcgcaccacttcatttacagg
gacttgaagcccgagaacctgatgctgggcactgatggctattgcaaactggtcgatttt
ggatttgccaagtttgtgcggcacaatgagaagaccaacacatttgcgggtacaccggag
tatgtggctcctgagatcatcctggatcgtggacacgaccgagccgtcgactattgggca
ctgggcattctcgtatatgaactgctggttggcaaaacccccttcaggggcgttaatcag
atcaagatctatcagcaaatcctcagtggcatcgacgtcatccatatgccatcgcgcatc
cccaagtccgcgcagcacctggtgcggcatctctgcaagcaacttccggcggaaagactg
ggctatcagcggaagggaatcgccgatatcaagcggcacagctggttcgaaagtctcgac
tggcagagactgaaacagaagcaattgccgtctcccatcaaaagacctttgaagagttgg
accgacttgcaatactttggtccttcgggtgttgagaacgactatgagccaccagaggaa
ctgagcgggtgggatcaagagttttaa

DBGET integrated database retrieval system