KEGG   Drosophila erecta: Dere_GG10156Help
Entry
Dere_GG10156      CDS       T01060                                 

Definition
GG10156 gene product from transcript GG10156-RA
Orthology
K18669  
dual specificity tyrosine-phosphorylation-regulated kinase 2/3/4 [EC:2.7.12.1]
Organism
der  Drosophila erecta
Brite
Enzymes [BR:der01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     Dere_GG10156
Protein kinases [BR:der01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   Dere_GG10156
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 718 aa AA seqDB search
MLDRCEMPIQLDNEKLRRDVRLSGSRLDLPQLCNGSRRLDGHNNHVAANEPTVTTTSLNG
NGNGSGNSNNNIGSPVSSSTTNSSNGGNERGSSTKSNSSSGSGSSGNSASSTASGELKCN
TPMTPSELVKKFRNYLTDLEFEELKVYKEVWYFGQHASKNYNKPAPTANTTNLGYDDDNG
NYKIIEHDHIAFRYEILEVIGKGSFGQVIRALDHKTNTHVAIKIIRNKKRFLNQAVVELN
ILDELREKDADGSHNVIHMLDYTYFRKHLCITFELMSLNLYELIKKNNYNGFSMSLIRRF
CNSIVKCLRLLYKENIIHCDLKPENILLKQRGSSSIKVIDFGSSCYVDRKIYTYIQSRFY
RSPEVILGLQYGTAIDMWSLGCILAELYTGFPLFPGENEVEQLACMMEVLGLPPKVLISV
ARRRRLFFDSRDAPRCITNTKGRKRSPGSKSLAQILHCQDRYFIDFLQRCLEWDPAERMT
PDEAAHHEFLQPSASSRHRSCRMSSSSSSSGLNSVSQKSSCYSFSEISPGTNGPVVASIT
STTAVHNAAIATTTKSRQQPPSQSHGHAQSNGHLPDIKLSASDKYNSMQKVAVRSKITSS
VSDLESVQQYSLHRIYGGVGSGSTHHVSSAATRKHLPGTGSGIVGAMTSKYGSSTLAHNH
HNVTHHNASTATIATTTHHHHHHGGQQQQQSSSGASTMAMSHSQSTGDVSDRAIFGRA
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atgttggatcgatgcgaaatgccgatccagctggacaacgagaagttgcgacgggatgtt
cggttgtcgggctctcgactggatttgccacaactatgtaatggatcgcgtcggttggat
ggccacaacaaccatgtggctgccaatgagcccacggttacgacgacatccctgaatggg
aatgggaacggcagtggtaacagcaacaacaacatcggatcgcccgtctcctcatcgaca
acaaacagcagtaatggcggcaacgagcgcggctcctccacgaagtccaacagcagcagt
ggaagtggcagctcgggaaactcggccagcagcacggcaagtggcgagctcaagtgcaac
acgcccatgacgccatctgagctggtgaagaagttccgcaactacctaaccgatctggag
tttgaagagctcaaggtgtacaaggaggtctggtattttggccagcacgccagcaagaac
tacaacaaacccgcccccacagccaacaccacaaatctgggctatgacgatgataatggc
aactacaagatcatcgaacacgatcacatagcctttcgttacgagattctggaggtgatt
ggcaagggcagttttggccaggtcatcagggcgctggatcacaagaccaacacacacgtg
gccatcaagatcataaggaacaagaagcgcttcctcaaccaggccgtcgtcgagctcaat
atcctcgacgagctgcgcgaaaaggacgcggatggatctcacaatgtcatacacatgctc
gactatacctatttccgcaagcatttgtgcataacttttgagcttatgagcttgaacctg
tacgaattgataaagaagaacaactacaatggattcagcatgagtctcattcgacgcttc
tgcaactcgatcgtgaagtgcctgcgtttgctctataaggaaaacattattcactgtgat
ctcaagccggaaaacatcttgctcaaacagcgtggtagcagctccattaaagtcatcgac
tttggcagctcatgctacgtggatcgcaaaatctatacgtacatccaatcgaggttctat
cgctccccggaggtgattctcggcctgcaatacggcaccgccatcgatatgtggagcttg
ggctgcattctggccgagctgtacacgggattccctctcttccccggcgagaacgaggtg
gagcagctggcctgcatgatggaggttctcggtctgccgcccaaggtgctcatatcggtt
gccaggcgacgtcggctcttcttcgattcccgtgatgccccgcgctgcataaccaacacc
aagggacgcaaacggtcgccaggcagcaagtcgctggcacagatcttacactgccaggac
cgctatttcatcgacttcctgcagcgttgcctggagtgggatcctgcggagcggatgacg
ccggacgaggcggcccaccacgagtttctgcagccctctgcctccagtcgccatcgcagc
tgccgcatgtcgagcagttcgtccagctccggactcaacagtgtttcccagaagtcttcc
tgctatagcttttcggagatctcgccgggcactaacggccccgtggtggcctcgatcacc
agcaccacggctgtgcataatgctgcgattgccaccacaaccaaatcgagacagcagccg
ccatctcagagtcatggccacgcccaatctaatggacacctgcccgacatcaagttgagt
gccagcgataagtacaacagcatgcagaaggtggcggtgcgctcgaagatcacgtccagc
gtctcggatctggagtccgtgcagcagtactccctgcatcgcatctacggaggagtgggt
agtggcagcacacaccatgtttcgtcagcggccaccaggaagcatttgcctggtacaggc
agtggaattgtgggtgccatgacttccaaatacggcagctcaacgttggcgcacaaccat
cacaatgtgacgcaccacaatgcatcgacggccacaattgccacgaccacgcaccaccat
caccaccatggtgggcagcagcaacagcagtcgtcgtcgggagcatccaccatggccatg
tcacactcccagtccaccggcgatgtctccgacagggccatctttgggagagcttga

DBGET integrated database retrieval system