KEGG   Drosophila erecta: Dere_GG10186Help
Entry
Dere_GG10186      CDS       T01060                                 

Definition
GG10186 gene product from transcript GG10186-RA
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
der  Drosophila erecta
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dere_GG10186
Enzymes [BR:der01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Dere_GG10186
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 297 aa AA seqDB search
MATTAAAMAATSVVVLDRGNNTTCTINLHGATVVSWRVNNQEQLFVSKLASFDGKKAIRG
GIPFVFPQFGAWSFGPQHGFARITRWHLERPPDRLHNGDVEAIFSLMDNDFTRSIWNYQF
RITYRLILREKELHFHIGVYNPSKELSFTFNMLLHTYLKVPDVRRCQITGLQGCHFIDKT
RENALYQEGREVVTVNEWTDRIYQHTPQEHVITNVVSGRKMRLHKYNFPDTVIWNPWIDR
SREMSDFGDDEFPNMLCVEAGNVTSPVILLPGTAYEASQILQIIIEGNVSRKTKRNR
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggccaccacagcggccgcaatggccgcaacgagtgtagttgttctggatcgcggaaac
aatacaacctgcaccatcaatttgcacggtgccacggtcgtgtcctggcgggtaaacaat
caggagcagttgtttgtcagcaaactggcctcattcgatggcaagaaggcgatacgtggt
gggattccgtttgtctttcctcagttcggtgcctggtccttcgggccacagcacggattt
gcgaggattaccaggtggcacctggagagaccgccagacaggctgcacaatggcgatgtg
gaggccatattctcgcttatggacaacgactttacgcgatccatctggaactatcagttt
cgcatcacttatcgtctgatcctacgggaaaaggagctacacttccacatcggcgtttac
aatcccagcaaggagctgagcttcaccttcaacatgctgctgcacacctacctaaaggtg
cccgatgtgcggcgatgtcagatcactggcctccagggctgccacttcattgacaagacg
cgggagaatgcgctctatcaggagggacgcgaggtggtcaccgtcaatgaatggaccgac
aggatctaccagcacacgccgcaggagcacgtcatcacaaacgtggtatccggccggaaa
atgagactgcacaagtacaattttcccgatacggtcatctggaatccttggattgatcga
tcgcgtgagatgagtgacttcggggacgacgagttccccaacatgttgtgcgtggaggcg
ggcaatgtgacctcgccggtgatcctgctgcctggcaccgcttacgaggccagccagatc
cttcagattatcatcgagggcaatgttagtcgcaagaccaagcggaatcgctag

  All links  
No link information was found.   
DBGET integrated database retrieval system